KEGG   Gallus gallus (chicken): 373932
Entry
373932            CDS       T01006                                 

Gene name
NKX3-2
Definition
(RefSeq) homeobox protein Nkx-3.2
  KO
K09995  homeobox protein Nkx-3.2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    373932 (NKX3-2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    373932 (NKX3-2)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 373932
NCBI-ProteinID: NP_989468
CGNC: 48963
UniProt: Q98TG7
Position
4
AA seq 276 aa
MAVRGGGGGGGTALTPFSIQAILNKKEERARGWRLCAARAEAPPPPAPRPPPAWDSDSAL
SEEPESERRSEEESAGGSARPPEAAGRGAAGGGGAALGGGGGRDRDRDGARSDSEASAAA
SGRGPAEEEEAAGGRLLAAEEEAAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPER
ADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLAAAPAAKKVAVKVLVRDDQRQYQPG
EVLRPPSLLALQPSYYYPYYCLPGWALSCAAAAGTQ
NT seq 831 nt   +upstreamnt  +downstreamnt
atggccgtccgcggcggcggcggcggcggcggcaccgccctgacgcctttctccatccag
gccatcctcaacaagaaggaggagcgcgcccgcggctggcggctgtgcgctgcccgcgcc
gaggccccgccgccgcccgccccgcgcccgccgcccgcctgggactcggactcggcgctg
agcgaggagcccgagagcgagcggcgctccgaggaggagagcgccgggggcagcgcccgc
ccccccgaggcggcgggcaggggggcggccggcggcggaggcgcggccctcggaggcggc
ggcggacgggaccgggaccgggacggagcgcgcagcgacagcgaagcgtcggccgccgcc
tcaggtcgcggcccggccgaggaggaggaggcggcgggcgggaggctgctggcggccgag
gaggaggcggcggcgccgaagccgcgcaagaagcgctcccgcgccgccttctcccacgcg
caggtgttcgagctggagcggcgcttcaaccaccagcgctacctgtcggggcccgagcgc
gccgacctggccgcctccctcaagctgaccgagacgcaggtgaagatctggttccagaac
cgccgctacaaaaccaagcggcggcagatggcagccgacctgctggccgccgcccccgcc
gccaagaaggtggccgtcaaggtgctggtgcgcgacgaccagagacagtaccagcccggc
gaggtgctgcggccgccctcgctgctcgccctgcagccctcctactactacccctactac
tgcctgcccggctgggccctgtcctgcgccgcggccgccggcacgcagtga

DBGET integrated database retrieval system