KEGG   Gallus gallus (chicken): 373934
Entry
373934            CDS       T01006                                 

Gene name
HOXA13
Definition
(RefSeq) homeobox protein Hox-A13
  KO
K09298  homeobox protein HoxA/C/D13
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    373934 (HOXA13)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    373934 (HOXA13)
SSDB
Motif
Pfam: HoxA13_N Homeodomain Homeobox_KN CI-B14_5a
Other DBs
NCBI-GeneID: 373934
NCBI-ProteinID: NP_989470
CGNC: 16060
Ensembl: ENSGALG00000027234
UniProt: Q90X25
Position
2
AA seq 290 aa
MFLYDNSLDEINKNMDGFHAGSNFAAAAAANPCRNLMAHPAPLAAPSAAAYTSSEAPAAG
MAEPAVKQCSPCSAAVQSSSGAALPYGYFGSGYYPCRMTHHNAIKSCAQPASTFADKYMD
TSVSGEEFTSRAKEFAFYQGYAAGPYQPVPGYLDVPVVPTIGGPGEPRHDSLLPMDSYQP
WAITNGWNGQVYCPKEQSQPPHLWKSTLPDVVSHPSDANSYRRGRKKRVPYTKVQLKELE
REYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKKVINKLKTTS
NT seq 873 nt   +upstreamnt  +downstreamnt
atgttcctctacgacaacagcctggatgagatcaataagaacatggacgggtttcacgcc
ggcagcaacttcgcggcggctgcggcggccaacccgtgccgcaacctgatggctcacccc
gcgcccctggccgcccccagcgccgccgcctacacgtcgagcgaggcccccgccgccggc
atggccgagcccgctgtcaagcagtgcagcccctgctccgccgccgtgcagagctcctcc
ggcgccgcgctgccctacggctacttcggcagcggctactacccgtgccgcatgacccac
cacaacgccatcaagtcctgcgcccagcccgcctccaccttcgccgacaagtacatggac
acgtcggtctccggcgaggagttcacgtcgcgggccaaggagttcgccttctaccagggc
tacgcggccgggccctaccagccggtgcccggctacctggacgtgcccgtggtgcccacc
atcggcggccccggcgagccgcgccacgactccctgctccccatggacagctaccagccg
tgggccatcaccaacgggtggaacgggcaagtgtactgccccaaggagcagagccagccg
cctcacctctggaagtccaccctcccggacgtcgtctcgcatccctcggatgcgaactcg
tacagacgtgggaggaagaagcgagtgccctacacaaaggtgcagttaaaagaactcgaa
agggaatacgctacaaataaattcataaccaaagacaaacggcggaggatatcggcgacc
acgaatctgtcagagcgacaggtcacaatctggttccagaacagaagggtcaaagagaaa
aaagtcatcaacaaattgaagacgaccagttaa

DBGET integrated database retrieval system