KEGG   Gallus gallus (chicken): 373941Help
Entry
373941            CDS       T01006                                 

Gene name
PRRX1
Definition
(RefSeq) paired mesoderm homeobox protein 1
  KO
K09329  paired mesoderm homeobox protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    373941 (PRRX1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    373941 (PRRX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain OAR Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 373941
NCBI-ProteinID: NP_001264653
CGNC: 48968
Ensembl: ENSGALG00000003324
UniProt: Q05437 Q8UVD3
Position
8
AA seq 245 aa AA seqDB search
MASSYAHAMERQALLPARLDGPAGLDNLQAKKNFSVSHLLDLEEAGDMVAAQGDEGGGEP
GRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPD
AFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLASKNASLLKSYSGDVTAVEQPIV
PRPAPRPTDYLSWGTASPYSAMATYSTTCTNASPAQGMNMANSIANLRLKAKEYSLQRNQ
VPTVN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccagctatgcccacgccatggagaggcaggccctgctgccagcccgcctcgac
ggccccgccggcctggacaatttacaagccaagaagaacttttccgtgagtcacctgctg
gacctggaggaggcgggcgacatggtggccgcgcagggggacgagggcggcggcgagccc
ggccggagcttgttggagtcccccgggctgaccagcggcagcgacaccccgcagcaggac
aatgatcagctgaattcagaagagaagaagaaaaggaagcagagaaggaacaggactacc
ttcaacagcagccagcttcaggcactagagagggtctttgagaggacacactaccccgat
gcctttgtacgggaagaccttgcacgcagagtcaacctcactgaagccagagttcaggtg
tggttccagaaccggagggccaagtttcgccggaatgagagggccatgctggccagcaag
aacgcctctctgctcaaatcctactcaggggatgtgaccgccgtggagcagcccatagta
cctcgcccagctccaagacccactgactatctctcctggggtaccgcctcgccttacagt
gccatggccacctactccaccacgtgtaccaacgccagcccggcgcagggcatgaatatg
gccaacagtattgccaacctgagactgaaggcaaaagaatatagtttacagaggaatcaa
gtgcccacagtcaattaa

DBGET integrated database retrieval system