KEGG   Gallus gallus (chicken): 373943
Entry
373943            CDS       T01006                                 

Gene name
TBX20
Definition
(RefSeq) T-box transcription factor TBX20
  KO
K10185  T-box protein 20
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    373943 (TBX20)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Other transcription factors
   T-box
    373943 (TBX20)
SSDB
Motif
Pfam: T-box
Other DBs
NCBI-GeneID: 373943
NCBI-ProteinID: NP_989475
CGNC: 9220
Ensembl: ENSGALG00000032097
UniProt: Q8UW76
Position
2
AA seq 440 aa
MEYTPPPKPQLSSRANAFSIAALMSSGSSKDKEAAESTIKPLEQFVEKSSCAQPLSDLSG
LEPHGDFSGSPSALCTEPLIPTTPIIPSEEMAKISCSLETKELWDKFHELGTEMIITKSG
RRMFPTIRVSFSGVDPEAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVH
PDSPFTGEQLMKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKDHTASLLNL
KSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERESVESLIQK
HSYARSPIRTYGGEDDLGDDSQATQSRGSAFTTSDNLSLSSWVSSSTSFPGFQHPQSLSA
LGTSTASIATPIPHPIQGSLPPYSRLGMPLTPSAIASSMQGTGPTFPSFHMPRYHHYFQQ
GPYAAIQGLRHSSAVMTPFV
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggagtacacaccgcccccgaagccgcagctctcgtcgcgggccaacgccttctccatc
gccgccctcatgtcgagcggcagctccaaggacaaggaggccgccgagagcaccatcaag
cctctggagcaattcgttgagaagtcctcctgcgcgcagcctctgagcgatctgtccggc
ctggagccccacggggacttcagcggcagcccctcggccctgtgtaccgagcccctcatc
cccaccacacccatcatccccagcgaggagatggccaaaatctcctgcagcctggagacc
aaggagctgtgggacaagtttcacgagctgggcaccgagatgatcatcaccaagtccggc
aggaggatgtttcccacgatcagggtttctttctcgggagtggatcctgaagccaagtac
atcgtgctaatggatatcgttccggtggacaataagagatacagatatgcctaccaccgc
tcctcctggctggtggctggcaaagccgaccctcctctcccagcaaggctctacgtgcac
cccgactccccgttcacgggtgagcagttgatgaagcagatggtgtcgttcgagaaagtg
aagctcacgaacaacgagctggatcagcatggccacatcattttaaactccatgcacaag
taccagccaagagtccacatcattaagaagaaagatcacacggcttctttgttaaatctg
aaatctgaagagttcaggacgtttatctttccagagacagtttttactgctgtcacagcc
taccagaatcaattgataaccaagttgaaaattgacagcaacccttttgccaaaggattc
cgcgactcttccagactcactgatatcgagagggaaagtgtggagagccttatccaaaag
cattcctacgcccgatccccgattcgaacctatggtggagaagatgatcttggagatgac
agccaggcaacgcaaagcagaggatcagcttttacaacatctgataacctgtccctcagt
tcctgggtatcctcttcaaccagttttcctggatttcagcatccccagtctttgagtgcc
ctgggtaccagcactgcatccattgctacacctattcctcatccaatccaaggatccttg
cctccatacagccgcttgggaatgcctcttacgccctctgcaatagccagctccatgcaa
ggtactggccccactttcccttctttccacatgccaaggtaccatcattattttcagcag
ggtccttatgcagccatccagggactgcgtcactcctccgcagtaatgacaccattcgta
tag

DBGET integrated database retrieval system