KEGG   Gallus gallus (chicken): 373949
Entry
373949            CDS       T01006                                 

Gene name
B3GAT1
Definition
(RefSeq) galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1
  KO
K00735  galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 [EC:2.4.1.135]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00515  Mannose type O-glycan biosynthesis
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    373949 (B3GAT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gga01003]
    373949 (B3GAT1)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.135  galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase
     373949 (B3GAT1)
Glycosyltransferases [BR:gga01003]
 Glycan extension
  O-Glycan
   373949 (B3GAT1)
SSDB
Motif
Pfam: Glyco_transf_43
Other DBs
NCBI-GeneID: 373949
NCBI-ProteinID: NP_001264768
CGNC: 48972
Ensembl: ENSGALG00000001611
Position
24
AA seq 334 aa
MPKRRDILAIVLIVLPWTLLITVWHQSTIAPLLAVHKDDGGDSRRDLAAGLDSKEYCLSD
RDIVEVVRTEYVYTRPPPWSDTLPTIHVITPTYSRPVQKAELTRLANTLLHVPNLHWILV
EDSQRRTPLITRLLRDTGLNYTHLNVETPRNYKLRGDMRDPRIPRGTMQRNLALRWLRET
FNKNNSQPGIVYFADDDNTYSLELFEEMRSTRKVSVWPVAFVGGLRYESPKVNAAGKVYG
WKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLRELVTLNDLEPK
AANCTKILVWHTRTEKPVLVNEGKKGFTDPNVEI
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgccgaagagacgagacatcctggctatcgtgctgatagttctgccctggacactacta
atcaccgtctggcaccagagcaccattgctccactgcttgcagtgcacaaggatgatggt
ggtgactcccggcgtgatctcgctgcaggcttggactccaaggaatactgcttgtcggac
cgggacattgtggaggtggtgaggacagaatatgtttatactcgcccacccccgtggtca
gacacccttcccactatccacgtcattacacccacctacagccggcccgtgcagaaagca
gagctgacgcgcctggccaacaccctcctgcatgtgccaaacctgcactggatcctggtg
gaggactcccagcggcgcacacccctcatcacccggctgctacgggacacggggctcaac
tacacccacctcaacgtggagacccctcgcaactacaagctgcggggagacatgagggac
ccccgcatcccccgggggaccatgcagaggaaccttgccctgaggtggctgagagagacc
tttaacaaaaacaacagtcagcctgggattgtttactttgctgatgatgataacacctac
agcctggagctcttcgaggagatgcgcagcaccagaaaggtgtcggtgtggccagtagcc
ttcgttggtggcttgcgctacgagtcccccaaagtgaatgctgcagggaaggtctacggc
tggaaaactgtgtttgacccccatcgcccctttgctatagacatggcagggtttgctgtg
aacctcaggctgatccttcagcgatctcaggcgtacttcaagctgcgaggagtgaaggga
ggctaccaggagagcagcctgctgcgggagctggtcaccctgaacgaccttgagccaaaa
gctgccaattgcactaagattttagtctggcacacgaggacagaaaagcctgtgctggtg
aatgaggggaagaaaggattcacagatcccaatgtggaaatctga

DBGET integrated database retrieval system