KEGG   Gallus gallus (chicken): 373953Help
Entry
373953            CDS       T01006                                 

Gene name
MAPK1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04012  ErbB signaling pathway
gga04068  FoxO signaling pathway
gga04114  Oocyte meiosis
gga04140  Autophagy - animal
gga04150  mTOR signaling pathway
gga04210  Apoptosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04350  TGF-beta signaling pathway
gga04370  VEGF signaling pathway
gga04371  Apelin signaling pathway
gga04510  Focal adhesion
gga04520  Adherens junction
gga04540  Gap junction
gga04620  Toll-like receptor signaling pathway
gga04621  NOD-like receptor signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04810  Regulation of actin cytoskeleton
gga04910  Insulin signaling pathway
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04916  Melanogenesis
gga04933  AGE-RAGE signaling pathway in diabetic complications
gga05132  Salmonella infection
gga05164  Influenza A
Module
gga_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    373953 (MAPK1)
   04012 ErbB signaling pathway
    373953 (MAPK1)
   04350 TGF-beta signaling pathway
    373953 (MAPK1)
   04370 VEGF signaling pathway
    373953 (MAPK1)
   04371 Apelin signaling pathway
    373953 (MAPK1)
   04068 FoxO signaling pathway
    373953 (MAPK1)
   04150 mTOR signaling pathway
    373953 (MAPK1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    373953 (MAPK1)
  Cell growth and death
   04114 Oocyte meiosis
    373953 (MAPK1)
   04210 Apoptosis
    373953 (MAPK1)
   04218 Cellular senescence
    373953 (MAPK1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    373953 (MAPK1)
   04520 Adherens junction
    373953 (MAPK1)
   04540 Gap junction
    373953 (MAPK1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    373953 (MAPK1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    373953 (MAPK1)
   04621 NOD-like receptor signaling pathway
    373953 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    373953 (MAPK1)
  Endocrine system
   04910 Insulin signaling pathway
    373953 (MAPK1)
   04912 GnRH signaling pathway
    373953 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    373953 (MAPK1)
   04916 Melanogenesis
    373953 (MAPK1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    373953 (MAPK1)
   04270 Vascular smooth muscle contraction
    373953 (MAPK1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    373953 (MAPK1)
  Infectious diseases
   05132 Salmonella infection
    373953 (MAPK1)
   05164 Influenza A
    373953 (MAPK1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     373953 (MAPK1)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   373953 (MAPK1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     373953 (MAPK1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   373953 (MAPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase FTA2 Choline_kinase Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 373953
NCBI-ProteinID: NP_989481
CGNC: 48975
Ensembl: ENSGALG00000001501
UniProt: Q8UWG6
Position
15
AA seq 368 aa AA seqDB search
MAAVAGAAAAGGSAGAGGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVA
IKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDL
YKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLAR
VADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKH
YLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDK
MLTFNPHKRIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETA
RFQPGYRS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggcgggggccgcggccgcgggcggctctgccggcgccgggggcccggag
atggtgcggggccaagtgttcgacgtggggccgcgctacaccaacctctcctacatcggc
gagggggcgtacggcatggtgtgttctgcctacgataacgtcaacaaagttcgagttgct
ataaagaaaatcagtccttttgagcatcagacgtactgccagagaactctgagagagata
aagatcttactgcgcttcaggcatgagaatattatcggaataaatgatattatcagagct
ccaactattgaacaaatgaaagacgtatacattgtgcaagaccttatggaaacagatctt
tacaagctcttaaagactcaacacctcagcaacgaccacatttgttatttcctttaccag
attctgagagggttaaaatatatccattcagccaatgtgcttcatcgcgacctcaaacct
tcgaatttgctgcttaataccacttgtgatctcaagatttgtgacttcggactggctcgt
gttgcagatccggaccatgatcacacaggattcctgacagagtatgtggccacacgttgg
tacagggctcctgaaatcatgctgaattctaagggttacaccaagtctattgacatctgg
tcagtaggctgtattctggcagagatgctctccaacagacccatctttccaggaaaacac
taccttgaccagcttaaccatatccttggtatacttggatccccttcccaagaagatttg
aattgtataataaatttaaaagccagaaactatttgctttccctaccacacaaaaataag
gtaccatggaacaggctgtttcccaatgctgaccccaaagcacttgatctgttggataaa
atgttgacctttaatcctcataagcgaattgaagtggagcaagctttagcccatccatat
ctggaacagtattacgatccaagtgatgagcctgtagctgaagcacccttcaagtttgat
atggaattggatgacttgccgaaggaaaagctgaaagaactgatttttgaggaaactgct
agattccagccaggatatcgatcttaa

DBGET integrated database retrieval system