KEGG   Gallus gallus (chicken): 373961
Entry
373961            CDS       T01006                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04110  Cell cycle
gga04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    373961 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    373961 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    373961 (HDAC1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     373961 (HDAC1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     373961 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     373961 (HDAC1)
    BRAF-HDAC complex
     373961 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    373961 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    373961 (HDAC1)
SSDB
Motif
Pfam: Hist_deacetyl RNA_polI_A34
Other DBs
NCBI-GeneID: 373961
NCBI-ProteinID: NP_989487
CGNC: 2394
Ensembl: ENSGALG00000003297
UniProt: P56517
Position
23
AA seq 480 aa
MALTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQPIPEDAVQEDSGDEEEEDPEKRISIRNSDKRISCDEEF
SDSEDEGEGGRKNVANFKKAKRVKTEEEKEEEEKKDEKEEEKAKEEKAEPKGVKEETKST
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggcgctgacgcaggggaccaagcggaaagtctgctactactacgacggtgatgttgga
aactattactatggccagggacaccccatgaagccccacaggatccggatgacccacaac
ctactgctgaactacggcctttacaggaagatggagatatatcgccctcacaaggcgaac
gcggaggagatgaccaagtaccacagtgatgactacatcaaattcctgagatccatccgc
ccagacaacatgtctgagtacagcaagcagatgcaaagatttaacgttggggaggactgc
cctgtgttcgatgggctgtttgagttctgtcagctctctgctggaggctccgttgccagc
gctgtgaagctgaacaagcaacagacagatattgctgtgaattgggcaggaggccttcac
cacgctaagaagtcggaggcttctggcttctgttatgtcaacgatattgtcctggctatc
ttggagctcttaaagtatcaccagagggtcctgtatattgacattgatattcaccatgga
gatggtgtggaggaagccttctataccacagaccgtgtgatgaccgtgtcctttcataag
tatggagagtacttcccaggaacaggggacctgcgggacattggtgcaggcaaaggcaaa
tactatgctgtcaactatcccctccgggatgggattgatgatgagtcctacgaggcaata
ttcaagccggtgatatctaaagtgatggagacattccagcctagtgcagttgtcctgcag
tgcgggtcggattctctgtccggggacaggctgggttgttttaatctgaccatcaaaggt
catgccaagtgtgtggagtttgtcaaaagttttaatttgcctatgctgatgctgggagga
ggtggctatacgatccgcaacgtggccagatgctggacctatgagactgctgtggctttg
gacactgagatcccaaatgagctcccatataatgactattttgagtacttcggaccagac
tttaagctgcacatcagtccctcaaacatgaccaaccagaataccaatgagtatctcgag
aagatcaagcagcgtctctttgagaatctgcgcatgctgcctcatgcccctggcgtccag
atgcagccaattcctgaggatgctgttcaggaagacagtggagatgaagaagaagaagat
cctgagaagcgcatttcaatccgcaattctgataagagaatatcctgtgatgaagaattc
tctgactctgaagatgaaggggaaggagggcgcaaaaatgttgccaactttaagaaggcc
aagcgtgtgaaaacagaggaggaaaaggaggaggaggagaagaaggatgagaaagaagag
gaaaaagcaaaagaggagaaagccgaacccaagggggtgaaggaagagacaaaatccacc
taa

DBGET integrated database retrieval system