KEGG   Gallus gallus (chicken): 373963
Entry
373963            CDS       T01006                                 

Gene name
EEF1A1
Definition
(RefSeq) elongation factor 1-alpha 1
  KO
K03231  elongation factor 1-alpha
Organism
gga  Gallus gallus (chicken)
Pathway
gga03013  RNA transport
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    373963 (EEF1A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    373963 (EEF1A1)
   03016 Transfer RNA biogenesis [BR:gga03016]
    373963 (EEF1A1)
   03012 Translation factors [BR:gga03012]
    373963 (EEF1A1)
   04131 Membrane trafficking [BR:gga04131]
    373963 (EEF1A1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    373963 (EEF1A1)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     373963 (EEF1A1)
Transfer RNA biogenesis [BR:gga03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    373963 (EEF1A1)
Translation factors [BR:gga03012]
 Eukaryotic type
  Elongation factors
   373963 (EEF1A1)
Membrane trafficking [BR:gga04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    373963 (EEF1A1)
Exosome [BR:gga04147]
 Exosomal proteins
  Proteins found in most exosomes
   373963 (EEF1A1)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 Gtr1_RagA G-alpha
Other DBs
NCBI-GeneID: 373963
NCBI-ProteinID: NP_001308445
CGNC: 48980
Ensembl: ENSGALG00000015917
UniProt: Q90835
Position
3
AA seq 462 aa
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
IGYNPDTVAFVPISGWNGDNMLEPSSNMPWFKGWKVTRKDGNASGTTLLEALDCILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPV
LDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMIPGKPMCVESFSDYPP
LGRFAVRDMRQTVAVGVIKAVDKKAGGAGKVTKSAQKAQKAK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgggaaaggagaagacccacatcaacatcgtcgtcatcggccacgtcgattccggcaag
tccaccaccaccgggcacctcatctacaaatgtggtggcatcgacaagaggaccatcgag
aagttcgagaaggaggcggccgagatgggcaaaggttccttcaaatatgcctgggtcttg
gacaagctcaaggctgagcgtgagcgtggtatcactatcgatatttccctgtggaaattt
gaaacaagcaagtactacgtcaccatcatcgatgctcctgggcacagagacttcattaag
aacatgattactggaacttctcaggctgattgtgctgtcctgattgttgctgctggtgtt
ggtgagttcgaggccggtatttctaagaacgggcagacccgtgagcacgctcttctggcc
tacaccctgggtgtgaaacagctgatcgttggtgttaacaagatggattccactgagcca
ccttacagccagaagagatacgaagagatcgtcaaggaagtcagcacttacatcaagaaa
attggctacaacccagacactgtagcttttgtgccaatctctggttggaacggggacaac
atgctggagcctagctctaacatgccctggttcaagggatggaaggttacccggaaagat
ggcaatgccagtggaaccaccctcctggaagccttggactgcatcctgcctccaactcgt
ccaactgacaaacctctgcgtctgcctcttcaagatgtctacaaaattggtggcattggt
actgtaccagttggccgtgtggaaactggtgtcctgaagccaggtatggtggtcacattt
gcccccgtcaacgttacaactgaagtaaagtctgttgagatgcaccatgaagcccttagc
gaagctctgcctggtgataacgttggcttcaacgtcaagaacgtgtctgtgaaagatgtc
cgccgtggtaacgttgctggtgacagcaagaatgatcctccaatggaagctgctggcttt
actgcgcaggttattatcctgaaccaccctggccaaatcagtgctggttatgcccctgtg
ctggattgccacactgctcacattgcctgcaagtttgctgagctcaaggagaagattgat
cgtcgttccggcaagaagctggaggatggcccgaagttcctgaaatctggagacgctgcc
attgttgatatgatccctggcaaacccatgtgtgttgagagcttctctgattatcctcct
ctgggtcgtttcgctgtgcgtgacatgagacagacggttgctgttggtgtcatcaaggcc
gtcgacaagaaggctggtggagccggcaaggtcacaaagtctgctcagaaggcccagaag
gctaaatga

DBGET integrated database retrieval system