KEGG   Gallus gallus (chicken): 373969
Entry
373969            CDS       T01006                                 

Gene name
DLX5
Definition
(RefSeq) homeobox protein DLX-5
  KO
K18489  homeobox protein DLX5
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    373969 (DLX5)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Dll
    373969 (DLX5)
SSDB
Motif
Pfam: DLL_N Homeodomain Homeobox_KN YdaS_antitoxin
Other DBs
NCBI-GeneID: 373969
NCBI-ProteinID: NP_989490
CGNC: 48983
Ensembl: ENSGALG00000009129
UniProt: P50577
Position
2
AA seq 286 aa
MTAVFDRRVPGIRSSDFQPPFQSAAAMHHPSQESPTLPESSATDSDYYSPTGAAPHGYCS
PTSASYGKALNPYQYQYGMNGSAGTYPAKAYADYGYGSPYHQYGGAYGRGQSSAGQPEKE
VAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQV
KIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLGHHGHGHP
PAANPSPGSYLESPSAWYPAASPLGSHLQPHGSLQHPLALPSGTIY
NT seq 861 nt   +upstreamnt  +downstreamnt
atgacagcagtgtttgacagaagggtccccggcatcaggtcctccgacttccagccgcct
ttccagagcgccgcagccatgcaccacccgtcccaggaatctcccactttacccgagtcc
tcggctacggattccgactactacagcccgacgggggcggccccgcacggctactgctcg
cctacctcggcttcctacggcaaagcgctcaacccctaccagtaccagtacggcatgaac
ggctccgccggcacctaccccgccaaagcctacgcggactacggctacggcagcccctac
caccagtacggaggcgcctacggccgcgggcaaagctccgcggggcagccagagaaggag
gtggcggagcccgaggtgaggatggtgaacggcaagccaaagaaagtgcgcaaaccgcgg
actatttattccagctttcagctggcggcgttgcagaggaggttccagaagacccaatac
ctcgccctgcccgagcgggccgagctggccgcctcgctgggactcacgcagacgcaggtg
aaaatctggttccagaacaaaaggtccaagatcaagaagatcatgaagaacggggagatg
cccccggagcacagccccagctccagcgaccccatggcctgcaactccccgcagtcgccg
gcggtgtgggaacctcagggctcgtcgcgctccctcggccaccacgggcacgggcacccg
cccgccgccaacccgtcccccggcagctacctggagagcccctcggcctggtaccccgcc
gccagccccctcggctcccacctgcagccccacggctccctacagcatcccttggcgctg
ccctccgggacgatctactga

DBGET integrated database retrieval system