KEGG   Gallus gallus (chicken): 373971Help
Entry
373971            CDS       T01006                                 

Gene name
TYR
Definition
(RefSeq) tyrosinase precursor
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00350  Tyrosine metabolism
gga01100  Metabolic pathways
gga04916  Melanogenesis
Module
gga_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    373971 (TYR)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    373971 (TYR)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     373971 (TYR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase Laminin_EGF
Motif
Other DBs
NCBI-GeneID: 373971
NCBI-ProteinID: NP_989491
CGNC: 12952
Ensembl: ENSGALG00000017237
UniProt: P55024 R9PXQ3
Position
1
AA seq 529 aa AA seqDB search
MFLFAMGLLLVILQPSTGQFPRVCANTQSLLRKECCPPWDGDGTPCGERSNRGTCQRILL
SQAPLGPQFPFSGVDDREDWPSVFYNRTCRCRGNFMGFNCGECKFGFSGQNCTERRLRTR
RNIFQLTISEKDKFLAYLNLAKNIPSKDYVIATGTYAQMNNGSNPMFRNINVYDLFVWMH
YYASRDTLLGGSNVWRDIDFAHEAPGFLPWHRAFLLLWEREIQKITGDENFTIPYWDWRD
AEDCVICTDEYMGGQHPTNPNLLSPASFFSSWQVICTQSEEYNSQQALCNATSEGPILRN
PGNNDKSRTPRLPSSSEVEFCLTLTQYESGSMDKMANYSFRNTLEGFADPHTAISNISQS
GLHNALHIYMNGSMSQVQGSANDPIFILHHAFVDSIFERWLRRHRPMLEVYPAANAPIGH
NRENYMVPFIPLYRNGEFFISSRELGYDYEYLQEPALGSFQDFLIPYLKQAHQIWPWLVG
AAVIGGIITAVLSGLILACRKKRKGTSPEIQPLLTESEDYNNVSYQSHF
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgtttgccatgggcttactgctggtcatccttcagccgtccactgggcagttc
cccagagtctgtgcaaacacgcagagcttgctgaggaaggagtgctgtccgccctgggat
ggagatgggaccccttgcggggagcgttccaacagaggaacctgccagcgcatccttctc
tctcaggctcctctgggaccacagttccctttctcaggagtggatgacagagaggattgg
ccttctgtcttttacaaccggacatgcagatgcagaggcaatttcatggggttcaactgt
ggggagtgcaagtttggcttctcaggacaaaactgcactgaaaggcgactgagaacgaga
agaaacatcttccagctcaccatcagtgagaaggacaagttccttgcctaccttaaccta
gcaaagaacatccccagcaaggactatgtaattgctactggcacatatgctcagatgaac
aacggctccaaccccatgttcagaaatatcaacgtgtacgatctcttcgtctggatgcat
tattatgcctctcgagacacactcttaggtggctccaatgtgtggagagacattgatttt
gcccatgaagcccctggttttctgccttggcatcgtgcttttctgctgctgtgggaacgt
gagatacagaagataacaggtgatgagaatttcaccatcccctactgggactggcgagat
gcagaggactgtgtgatctgcactgatgaatacatgggtggccaacaccccaccaaccct
aatttactcagcccagcatcatttttctcctcatggcaggtaatctgcactcaatctgaa
gagtacaacagccaacaggctttatgcaatgccactagtgaagggcctatacttcgaaat
cctggaaacaatgacaaatcaaggaccccaagactcccatcttcatcagaagtcgaattt
tgtcttacactcactcagtatgaatctggatccatggataaaatggccaattacagcttc
cgaaacactttggaaggctttgctgatccacacactgcaatatcaaacatatctcaaagt
ggtttgcataatgcccttcacatctacatgaatggctcaatgtcccaagtacaaggctct
gcgaatgatcctatcttcatcctacaccatgcatttgttgacagcatttttgagcggtgg
ttaagaagacacagacccatgctagaagtttacccagcagccaacgcacccattgggcac
aatcgagaaaattacatggttccctttatccctctttacagaaatggagaattttttata
tcatcaagagagctggggtatgactatgagtatctgcaagaaccagcacttggttctttc
caggactttttaatcccctacctcaagcaagcccatcagatctggccctggctggttggc
gcagctgtgatcggaggcataattactgctgtgctctctgggctcatcctggcctgcagg
aagaaaagaaaaggaacttctccagaaatacaacccttactcacagaaagtgaagattac
aacaatgtatcttatcaatcccatttctaa

DBGET integrated database retrieval system