KEGG   Gallus gallus (chicken): 373974
Entry
373974            CDS       T01006                                 

Gene name
IRX4
Definition
(RefSeq) iroquois-class homeodomain protein IRX-4
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Homeobox_KN Homeodomain MCM_bind MRP-S32 Zip
Other DBs
NCBI-GeneID: 373974
NCBI-ProteinID: NP_001001744
CGNC: 15827
Ensembl: ENSGALG00000022896
UniProt: Q9YGS0
Position
2
AA seq 485 aa
MSYPQFGYPYSSAPQFLMSTNSLTPCCESGGRTLPESGPAAPAQTPVYCPVYESRLLATA
RHELNSAAALGVYGGPYGGPQGYGNYVTYGTEAPAFYSLNTLEAKDGGGSAHAGISPAAA
YYPYEHSLSQYQYDRYGAMDGGTRRKNATRETTSTLKAWLQEHRKNPYPTKGEKIMLAII
TKMTLTQVSTWFANARRRLKKENKMTWPPRNKCSDEKRPYEEEEEEEEECSQEDAMKSEK
AEEPTGKEEKELELSDLEDLDAAESESSECEMRRPFPHPHPHPLPGGGPPPRAAEPPAAA
AEEEEEEAAERARGCLKPAAEECEAALLGARPRGCEAKLCFPQGQPLLEAKPRIWSLAHT
ATSLNQAEYPSCMLKRSGGSAAAAVSAPVSVMDRHQDSPVTNLRNWVDGVFHDPLFRHST
LNQALSNTTVSWATTKGAILETGALGRSVGNGANVLKGQLANLAHQDSSKEFLAFPKAGS
KMFCS
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgtcctacccgcagttcggctatccctactcctccgcgccccagttcctgatgagcacc
aactccctgacgccctgctgcgagtccggcggccgcacgctgcccgaatcgggcccggcc
gccccagcacagacgccggtctattgtcccgtctacgagagccgtctgctcgccaccgct
cgccacgagctcaactccgccgccgctctgggggtctacggcggcccctacggcggcccc
cagggctacgggaactacgtgacctacggcaccgaggcgcccgccttctactctctgaac
actttggaggcgaaggacggcggcggctctgcgcatgcgggcatctccccggcggctgct
tactacccctacgagcacagcctcagccagtaccagtacgacaggtacggggcgatggac
ggcggcacgcggcggaagaacgccacccgggagaccaccagcacgctgaaggcctggctg
caggagcaccgcaagaacccctaccccaccaagggcgagaagatcatgctggccatcatc
accaagatgactctcacccaggtctccacctggtttgccaacgcccgccgccgcctcaag
aaggagaacaagatgacgtggccgcctcggaacaagtgctcggacgagaagcggccctac
gaagaagaggaggaggaggaggaggaatgctcgcaggaagacgccatgaagagcgagaag
gccgaggagcccacgggcaaggaggagaaggagctggagctcagcgacctggaggatttg
gacgccgccgagtcggagagctccgagtgcgagatgaggcggcccttcccgcacccgcat
cctcacccgctgccgggcggcggccccccgccccgcgccgccgagccccccgccgccgcc
gccgaggaggaggaggaggaggcggcggagagggcccgcggctgcctgaagccggcggcg
gaggagtgcgaggcggccctgctcggggctcggccgcgcggctgcgaggccaagctgtgc
ttcccgcagggccagccgctgctggaggccaagccccgcatctggtccctggcgcacacc
gccacctccctcaaccaggccgagtacccctcctgcatgctgaagcggtcggggggatcg
gccgccgccgccgtctccgccccggtcagcgtcatggaccggcaccaggattcgccggtc
accaacctcaggaactgggtggacggggtgtttcacgacccgctgttcaggcacagtact
ttgaatcaagccttgagcaacaccacggtgtcctgggccaccaccaaaggagccattctg
gaaacgggcgccttgggacgctcggtgggcaatggtgccaacgtgctcaaggggcagctg
gccaacctggcccaccaggactcgagcaaggagtttctcgcctttcccaaagcagggagc
aaaatgttttgctcctaa

DBGET integrated database retrieval system