KEGG   Gallus gallus (chicken): 373976Help
Entry
373976            CDS       T01006                                 

Gene name
ALX4
Definition
(RefSeq) homeobox protein aristaless-like 4
  KO
K09451  homeobox protein aristaless-like 4
Organism
gga  Gallus gallus (chicken)
Brite
Transcription factors [BR:gga03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Prd
    373976 (ALX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox OAR Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 373976
NCBI-ProteinID: NP_989493
CGNC: 48987
Ensembl: ENSGALG00000032584
UniProt: O93582
Position
5
AA seq 387 aa AA seqDB search
MNADTCVSYCDPAAMDSYYNAASQGADGSSPFRAFQASDKFGPAFLAAKGQSFGDSGAKC
RSRYSPQECPSLDGSGQAPGPAAPPPAFSKYPQPQQQPPHLYMQRGPCKTPPESNLKLQE
SGGHNGALQVSCYGKESSLGEADLQPNADPSGMDSSYLSVKEAGVKVPQDRASTDLPSPM
DKADSESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWF
QNRRAKWRKRERFGQMQQVRTHFSTAYELPLLTRAENYAQIQNPSWIGNNGAASPVPACV
VPCEPVPSCMSPHAHPHAAGGVSDFLGVSSTGGHVGQTHVGGLFGTAGIGPSLNGYELNS
EPDRKSSSIAALRMKAKEHSAAISWAT
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgatacttgtgtttcttattgtgatccggctgccatggattcctactacaac
gcagcctcccagggcgcagacggctcctcgccttttagggcatttcaagcgagtgacaag
ttcggccccgctttcctggccgccaaaggacagagcttcggtgacagcggcgcgaagtgc
cggagccgctacagcccgcaggaatgcccgtccctggacggcagcgggcaggcgccgggc
cccgccgcgcccccgcccgcctttagcaaatacccgcagccccagcagcagccgccgcac
ctctacatgcagcgcggcccctgcaagacccccccggagagcaacctcaagctgcaggag
agcggcggccacaacggagccctgcaggtctcctgttacggtaaggagagcagtttggga
gaggctgacttgcagcccaacgccgacccctcgggcatggacagcagctacctcagcgtg
aaggaggctggagtgaaagtccctcaggacagggccagcacggacctccccagccccatg
gacaaggcggactcggagagcaacaagggcaaaaaacggaggaaccgcaccaccttcacc
agctaccagctggaggagctggagaaggtcttccagaagacccactacccagatgtctat
gccagggagcagctagccatgaggacagacctcaccgaggcccgagtacaggtctggttc
cagaatcgacgagccaaatggcgcaagcgggagcggtttggccagatgcagcaggtccgg
acccacttctccactgcctatgagttgcctctgctcactcgtgctgagaactatgcccaa
atccagaacccctcttggattggcaacaatggagctgcctcccctgtgcctgcttgtgtt
gtcccctgcgagccggtgccctcctgcatgtccccccacgcgcatccccacgcggctggc
ggtgtctccgacttcctcggtgtctctagcactggcggccacgtgggccagactcacgtg
ggtggcctctttggtacggccggcattggccccagcctcaacggctacgagctgaacagc
gagccggaccgcaagagctccagcatcgcggccctgcggatgaaggcgaaggagcacagc
gccgcgatctcctgggcaacatga

DBGET integrated database retrieval system