KEGG   Gallus gallus (chicken): 373988
Entry
373988            CDS       T01006                                 

Gene name
TBX5
Definition
(RefSeq) T-box transcription factor TBX5
  KO
K10179  T-box protein 5
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    373988 (TBX5)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Other transcription factors
   T-box
    373988 (TBX5)
SSDB
Motif
Pfam: T-box
Other DBs
NCBI-GeneID: 373988
NCBI-ProteinID: NP_989504
CGNC: 6251
Ensembl: ENSGALG00000008253
UniProt: Q9PWE8
Position
15
AA seq 521 aa
MADTEEGFGLPSTPVDSEAKELQAEAKQDPQLGTTSKAPTSPQAAFTQQGMEGIKVFLHE
RELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNK
WSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQ
PRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGSD
DMELHRMSRMQSKEYPVVPRSTVRQKVSSNHSPFSGETRVLSTSSNLGSQYQCENGVSST
SQDLLPPTNPYPISQEHSQIYHCTKRKDEECSTTEHPYKKPYMETSPAEEDPFYRSSYPQ
QQGLNTSYRTESAQRQACMYASSAPPTDPVPSLEDISCNTWPSVPSYSSCTVSAMQPMDR
LPYQHFSAHFTSGPLMPRLSSVANHTSPQIGDTHSMFQHQTSVSHQPIVRQCGPQTGIQS
PPSSLQPAEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSENS
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggcggacaccgaggaaggcttcgggctcccgagcacgccggttgactcggaggccaag
gagctgcaggctgaggccaagcaggatccccagctggggaccaccagcaaggcccccacc
tctccacaggcggccttcacccagcagggcatggaggggatcaaagtgtttttgcacgag
cgggagctgtggctgaaatttcacgaggtggggacggagatgatcataacaaaggctgga
aggcgtatgtttcccagttacaaagtgaaggtcactggactcaatccaaaaacgaagtac
atactgttgatggatattgtaccagcggatgaccacagatacaaatttgcagataataaa
tggtccgtgaccgggaaggcagaaccggccatgcccggccgcctctacgtgcaccccgac
tcccccgctactggagcccactggatgaggcagttggtttccttccagaagctcaagctc
accaacaaccaccttgaccccttcggacatatcatcctgaactccatgcacaaataccag
ccccggctccacatcgtgaaggcggatgagaacaacggctttggctccaagaacactgcc
ttctgcacccatgtcttccccgagactgccttcatcgctgttacctcctaccaaaaccac
aagatcactcagctgaagattgagaacaaccccttcgcaaaaggtttccgcggcagcgat
gacatggagctccacaggatgtccaggatgcagagtaaagagtacccagttgttcccagg
agcacagtgagacagaaagtgtcctcgaatcacagccccttcagcggtgagaccagggtc
ctttccacctcctccaacctgggctcccagtaccagtgtgagaacggggtgtcaagcacc
tcccaggacctgctgccgcccaccaacccctacccgatctcccaggagcacagccagatc
taccactgcaccaagagaaaagatgaggaatgttccaccaccgagcatccctacaagaag
ccctacatggaaacttcaccagcggaagaggatcctttctacaggtccagttacccccag
caacagggactgaacacttcgtacaggactgaatcagcccagcgccaggcatgtatgtac
gccagctctgctccccccacggaccccgtgcccagcctggaagacatcagctgtaacacg
tggcccagcgtgccgtcctacagcagttgcacagtgtctgccatgcagcccatggacagg
ttaccctaccagcatttctctgcccacttcacctcggggcctctgatgccccggctcagc
agcgtggccaaccacacgtccccccagataggagacacccatagcatgttccagcaccag
acctcagtttctcaccaacccattgtgcggcagtgtggacctcagaccggcatccagtct
ccccccagcagcttgcagcctgcagagttcctctattcccacggcgtgcctcgaaccctc
tcgccccaccagtaccactcggtgcacggtgtgggcatggtgccagagtggagcgagaac
agctaa

DBGET integrated database retrieval system