KEGG   Gallus gallus (chicken): 373989
Entry
373989            CDS       T01006                                 

Gene name
TBX4
Definition
(RefSeq) T-box transcription factor TBX4
  KO
K10178  T-box protein 4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    373989 (TBX4)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Other transcription factors
   T-box
    373989 (TBX4)
SSDB
Motif
Pfam: T-box
Other DBs
NCBI-GeneID: 373989
NCBI-ProteinID: NP_001025708
CGNC: 48992
Ensembl: ENSGALG00000005285
UniProt: O93288
Position
19
AA seq 541 aa
MLQEKSLSETEEGFPTAPAPGHADSSAGSPVLGVAGGSSTPLSSPQLPDPEQTIENIKVY
LHEKELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYILLIDIVPADDHRYKFC
DNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMH
KYQPRLHIVKADENNAFGSKNTAFCTHVFPETSFISVTSYQNHKITQLKIENNPFAKGFR
GSDDSDLRVARLQSKEYPVISKSIMRQRLVSSHGQLSTKPDVNPLHGSHQTLQHYQYENG
AHMQFAASDTQDLSLNTFTAQRDSGLFYHCLKRRESARHLDLPCKRSYLEASSSVGDDHY
FRSPPPYEQQMLSPSYCSEVAPREACMYSGSGAEIAGVPAVDDLPPPPPPLSCNMWTSVA
PYTSYSVQTMETVPYQPFPAHFTATTMMPRLPSIAGQGSQPPGNSHFSVYNQLAQSQVRE
RVPPSSFPRERVHPSVCERKPPSPHLNAANEFLYSQSFSLSRESSLQYHSGMGTVENWTD
G
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgctccaggagaaaagcctgtctgaaaccgaggaagggtttccaacagcccccgcaccc
ggccatgcggactcctccgcgggctcccccgtcctcggcgtagccgggggcagcagcact
ccgctcagcagcccgcagctccccgaccccgagcagacgatagaaaacatcaaagtctat
ctccacgagaaggagctatggaagaagttccatgaagcgggcaccgaaatgatcataacc
aaagcaggcaggaggatgtttccgagctacaaggtcaaggtgactggaatgaaccccaag
accaagtacattctgttgattgacattgtcccagctgatgaccaccggtataaattctgt
gacaataaatggatggtggctgggaaggcagaacccgccatgccgggccggctgtatgtg
caccctgactcgcctgccactggagcgcactggatgcggcagctcgtgtccttccagaag
ctgaagctcaccaacaaccacctggatcccttcgggcatatcatcctcaattcaatgcac
aaataccagccgcggctgcacattgtgaaggcagatgagaacaatgcttttggctcaaag
aacacggccttctgcacccacgtgtttccagagacgtcctttatctcggtgacctcctac
cagaaccacaagataactcagctgaaaattgagaacaacccctttgcaaagggattcagg
ggaagtgacgacagcgacctgcgcgtggcacggctccaaagcaaagaatacccagtgatt
tccaaaagcatcatgaggcagagattggtgtccagccatggccagctctcgaccaagcca
gatgttaacccgctccatggcagtcaccagaccctacaacactatcagtatgagaatggt
gctcacatgcagtttgcagcctcagatactcaagacctgtcactcaacaccttcacagca
cagagagattcagggctcttctatcactgcctgaagagaagagaaagtgcgcggcacctg
gacctgccctgcaagcgctcctacctggaggcctcctcatcggtgggtgacgatcactac
ttccgctccccaccaccctacgagcagcagatgctgagcccgtcctactgcagtgaggtg
gccccgcgggaagcctgcatgtactctgggtcaggggctgagatcgcgggtgtgccggca
gtggatgacttgccacctccgcctcccccgctgagctgcaatatgtggacttcagtcgca
ccttacaccagctacagtgttcagacaatggaaactgtgccctaccagcccttcccagcc
catttcacagccaccaccatgatgccgcggctcccttctatcgcagggcagggctcgcag
cccccagggaacagccacttcagcgtctacaaccagctggcccagtctcaggttcgggag
cgtgtccccccatcatctttcccaagggaaagagtgcatccgtccgtgtgtgagaggaag
ccaccttccccacacctcaacgctgccaatgagttcctctactcccaaagcttctccttg
tcacgagagtcctcgctgcagtaccattcaggaatggggacggtggagaactggacggac
gggtga

DBGET integrated database retrieval system