KEGG   Gallus gallus (chicken): 374004
Entry
374004            CDS       T01006                                 

Gene name
MYOG
Definition
(RefSeq) myogenin
  KO
K18483  myogenic factor 4 (myogenin)
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    374004 (MYOG)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Myogenic transcription factors
    374004 (MYOG)
SSDB
Motif
Pfam: Basic HLH DUF3080
Other DBs
NCBI-GeneID: 374004
NCBI-ProteinID: NP_989515
CGNC: 48999
Ensembl: ENSGALG00000000172
UniProt: P17920 C4P6Q3
Position
26
AA seq 227 aa
MELFETNPYFFPEQRFYDGENFLGSRLQGYEAAAFPERPEVTLCPESRGALEEKDSTLPE
HCPGQCLPWACKICKRKTVSIDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKV
EILRSAIQYIERLQSLLSSLNQQEREQRELRYRPAAPQPAAPSECGSGSSSCSPEWSTQL
EFGTNPADHLLSDDQAEDRNLHSLSSIVESIAVEDVAVTFPEERVQN
NT seq 684 nt   +upstreamnt  +downstreamnt
atggagctctttgagaccaacccttactttttcccggagcagaggttttacgatggggaa
aacttcctgggctcccgcttgcagggctacgaggcggccgcgtttcctgagcgtcccgag
gtgaccctgtgccctgaaagcagaggggctttggaggagaaggactcgacgctgcccgag
cactgccccgggcaatgcttgccatgggcttgcaaaatctgcaagcgcaaaaccgtgtcc
atcgaccggcgtcgggcggccacgctgcgggagaagcggaggctgaagaaggtgaacgaa
gccttcgaggctctgaaacgcagcactctgctcaaccccaaccagcggctgcccaaggtg
gagatcctgcgcagcgccatccagtacatcgagcgcctgcagagcctgctcagcagcctc
aaccagcaggagcgtgagcagagggagctgcgctaccgccccgctgcaccacaacctgct
gcacccagcgagtgcggctctggcagctcatcctgcagccctgagtggagcacccagctg
gagtttggcaccaaccccgcagatcacctcctgagcgatgaccaggcagaggaccgcaac
ctccactcgctctcctccatcgtggagagcatcgccgtggaggacgtggccgtgacgttc
ccagaggagcgggtccaaaactga

DBGET integrated database retrieval system