KEGG   Gallus gallus (chicken): 374007
Entry
374007            CDS       T01006                                 

Symbol
CDH7
Name
(RefSeq) cadherin-7 precursor
  KO
K06799  cadherin 7, type 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    374007 (CDH7)
Cell adhesion molecules [BR:gga04515]
 Cadherins
  Major cadherins
   374007 (CDH7)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_2 Cadherin_3
Other DBs
NCBI-GeneID: 374007
NCBI-ProteinID: NP_989518
CGNC: 49001
Ensembl: ENSGALG00000013782
UniProt: Q90763
Position
2
AA seq 785 aa
MKLGKVEFCHLLQIIALFLCLSGMNQAEPSRSRSKPYFQSGRTRTKRSWVWNQFFVLEEY
MGSDPLYVGKLHSDVDKGDGSIKYILSGEGASSIFIIDENTGDIHATKRLDREEQAYYTL
RAQAHDRLTNKPVEPESEFVIKIQDINDNEPKFLDGPYTAGVPEMSPVGTSVVQVTATDA
DDPTYGNSARVVYSILQGQPYFSVEPKTGIIKTALPNMDREAKDQYLLVIQAKDMVGQNG
GLSGTTSVTVTLTDVNDNPPRFPRRSYQYNVPESLPLASVVARIKAADADVGPNAEMEYK
IVDGDGLGVFKISVDKDTQEGIITIQKELDFEAKTSYTLRIEAANMHVDPRFLSLGPFSD
MTTVKIIVEDVDEPPVFTSRLYSMVVSEAAKVGTIIGTVAAHDPDASNSPVRYSIDRNTD
LERYFNIDANSGVITTAKSLDRETNAVHNITVLAMESQNPAQIGRGYVAITILDINDNAP
EFAMEYETTVCENAQPGQIIQKISAIDKDDPPNGHQFYFSLTAEAANNHNFTLQDNKDNT
ATVLTRRNGFRRQEQSVFYLPIFIVDSGSPSLSSTNTLTIRVCDCDADGIAQTCNAEAYI
LPAGLSTGALIAILACVLTLLVLVLLIVTMRRRKKEPLIFDEERDIRENIVRYDDEGGGE
EDTEAFDMAALRNLNIIRDTKTRRDVTPEIQFLSRPTFKSIPDNVIFREFIWERLKEADV
DPCAPPYDSLQTYAFEGNGSVAESLSSLDSISSNSDQNYDYLSDWGPRFKRLADMYGSGP
DCLYS
NT seq 2358 nt   +upstreamnt  +downstreamnt
atgaagttgggcaaagtggagttctgccatttgttgcagataatagctcttttcctgtgt
ctttctgggatgaatcaagctgaaccctcgaggtccaggtcaaagccctactttcagtct
gggaggacgagaaccaaacgcagctgggtgtggaatcaattctttgtgctggaagaatac
atgggctcagacccactctatgtaggaaagcttcactctgatgttgataaaggagatggt
tccatcaaatacatcttgtcaggagaaggggcaagttccattttcattattgatgagaac
acaggggatattcacgctacaaagaggctggatcgagaagagcaggcctactacacactc
cgagcacaagcgcatgataggctgactaataaaccggtggaaccagaatctgagttcgtc
attaagattcaggacatcaatgacaatgagccaaaatttctggatggtccttacactgct
ggagttcctgagatgtctcctgtgggtacctctgtggttcaagtgacagccactgatgca
gatgatcctacttatggcaatagtgcccgagtggtttacagcatattgcaaggacaacct
tacttttctgtggaaccaaagacaggcattatcaaaactgcccttccaaatatggataga
gaagccaaggaccaatacttactagttattcaagcaaaggacatggttgggcaaaatggt
ggattatcaggaacaacatctgtaactgtcactctgactgatgttaatgacaacccaccc
cgcttcccacgacgatcatatcagtataatgtcccagagtctttacctctggcatctgta
gtggccagaataaaagctgcagatgcagatgtgggacccaatgctgaaatggagtataag
attgtagatggtgatggtttgggagtattcaaaatttctgtagacaaagacactcaggaa
ggaatcatcacaattcagaaggagttggattttgaagctaaaacaagttataccctgagg
atagaagcagccaatatgcatgttgatcctcgcttcctaagtctgggacccttcagcgac
atgacaacagtgaagataatcgtagaagatgttgatgagccacctgtgtttacttcacgt
ttatactccatggtggtgtctgaagcagcaaaagtcggcactatcattggaactgttgct
gcccatgatccagatgcctcaaatagtccagtcaggtactcaatagatcgaaacacagac
ctcgagaggtatttcaatattgatgccaacagtggagtcattacaactgccaagtctttg
gacagggaaactaatgctgttcataacattacagtcttggctatggagagtcagaatcca
gcacagattgggagaggatatgtagccataactatccttgacatcaacgacaatgcccct
gagtttgccatggagtatgagacaactgtctgtgaaaatgctcaacctggccagatcatc
cagaaaatcagtgcaattgataaagatgacccaccaaatggtcatcagttctacttcagt
ttaacagcagaagcagcaaataaccataattttacacttcaggacaacaaagataacact
gcaactgtattaaccagacgaaatggtttccgaagacaggaacaatctgttttctacttg
ccaatattcattgtggacagcggatcaccttcacttagtagcactaataccctcaccata
agagtctgtgactgcgatgcagatggtattgctcagacatgcaatgcagaggcatatatc
ttgcctgcgggacttagcactggagccctgatagcaatattggcttgtgttttaacattg
ctagttcttgtcttgctgattgtcaccatgaggcgacgaaaaaaagagcccctcattttt
gatgaagagagagatatcagagaaaatattgtcagatatgatgatgagggtggtggagaa
gaagacactgaggcttttgacatggctgccttaagaaacctcaacatcatccgagacacc
aagaccaggagggatgtgacacctgagattcagttcttgagcagaccgacttttaaaagc
atcccagataatgtcatttttagggaatttatctgggagagactaaaagaagctgatgtg
gacccttgtgcaccaccctacgactccctgcagacatatgcgtttgaggggaatggctca
gtggcagagtcactcagctcattagattcaataagctcaaactctgaccagaactatgat
tacctcagtgactggggtcctcgctttaaaaggcttgcagatatgtatgggagtggtcca
gactgcttatactcatag

DBGET integrated database retrieval system