KEGG   Gallus gallus (chicken): 374019
Entry
374019            CDS       T01006                                 

Gene name
SOX3
Definition
(RefSeq) SRY-related protein CH3
  KO
K09267  transcription factor SOX1/3/14/21 (SOX group B)
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    374019 (SOX3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    374019 (SOX3)
SSDB
Motif
Pfam: SOXp HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 374019
NCBI-ProteinID: NP_989526
CGNC: 66181
UniProt: Q9PSV6
Position
4
AA seq 316 aa
MYSMLETEIKTPQPTPGSAGGNPAPGGNGKGGGGAGSGAGAGSDQDRVKRPMNAFMVWSR
GQRRKMAQENPKMHNSEISKRLGADWKLLSDAEKRPFIDEAKRLRAVHMKEYPDYKYRPR
RKTKTLLKKDKYSLPGNLLAPGGGNAVSSPVGVGQRIDTYAHMNGWTNGAYSLMQDQLGY
GQHPGMNSPQLQQMHRYDMPGLQYSPMMSTAQTYMNAASTYSMSPAAYGQQPSTAMSLGS
MGSVVKSEPSSPPPAITSHSQRACLGDLRDMISMYLPPGGDATDPSALQGSRLHSVHQHY
QSAGTAVNGTVPLTHI
NT seq 951 nt   +upstreamnt  +downstreamnt
atgtacagcatgctggagaccgagatcaagacgccgcagcccacgccgggcagcgccggg
gggaacccggccccgggcggcaacggcaaaggcggcggcggggccggcagcggagcgggt
gccgggtcggaccaggaccgggtgaagcgccccatgaacgccttcatggtgtggtcccgg
ggccagcggcggaagatggcccaggagaatcccaagatgcacaactcggagatcagcaag
cgcctcggggccgattggaagctgctgagcgatgccgagaagcggcccttcatcgacgag
gccaagaggctgcgggccgtgcacatgaaggagtacccggattacaaataccggccccgg
aggaagaccaagaccttgctgaagaaggacaaatactcgctgccgggcaacctgctggcc
cccggagggggcaacgcggtgagcagccccgtcggggtgggccagaggattgacacttac
gcccatatgaacggttggaccaacggggcttactccctgatgcaagaccagctgggttac
gggcagcacccgggcatgaacagcccgcagctgcagcagatgcaccgctacgacatgccg
ggcctgcagtacagccccatgatgtccacggcgcagacctacatgaacgccgcctccacc
tacagcatgtcccccgccgcctacggccagcagccctccacggccatgagcctgggctcc
atgggctcggtggtgaagtccgagcccagctcgcctccgccggccatcacctcgcactcg
cagagggcctgcctgggagacctgcgggatatgatcagcatgtacctgcccccggggggc
gacgccacagacccttcggccctgcagggcagcaggttgcacagtgtgcaccagcactac
cagagtgccgggactgccgtgaacggcaccgtaccactaactcacatataa

DBGET integrated database retrieval system