KEGG   Gallus gallus (chicken): 374020
Entry
374020            CDS       T01006                                 

Gene name
FECH
Definition
(RefSeq) ferrochelatase, mitochondrial precursor
  KO
K01772  protoporphyrin/coproporphyrin ferrochelatase [EC:4.99.1.1 4.99.1.9]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00860  Porphyrin and chlorophyll metabolism
gga01100  Metabolic pathways
Module
gga_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    374020 (FECH)
Enzymes [BR:gga01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.1  protoporphyrin ferrochelatase
     374020 (FECH)
    4.99.1.9  coproporphyrin ferrochelatase
     374020 (FECH)
SSDB
Motif
Pfam: Ferrochelatase FAM91_C
Other DBs
NCBI-GeneID: 374020
NCBI-ProteinID: NP_989527
CGNC: 2220
Ensembl: ENSGALG00000038461
UniProt: O42479
Position
Z
AA seq 402 aa
MAAAGRAARPLVAGGRQLRVPLRWRGQVAAAAPSTKPQAEPETRKPKTGILMLNMGGPER
LDDVHDFLLRLFLDRDLMTLPAQNKLAPFIAKRRTPRIQEQYSRIGGGSPIKKWTAVQGE
GMVKLLDSMSPQTAPHKYYIGFRYVHPLTEEAIEEMEDDGIERAIAFTQYPQYSCSTTGS
SLNAIYRYYNKKGKKPKMKWSIIDRWPTHPLLIQCFADHIQKELDLFPPDKRKDVVILFS
AHSLPMSVVNRGDPYPQEVGATVQRVMEKLNHSNPYRLVWQSKVGPMPWLVPQTDETIKG
LCQRGKKNMLLVPIAFTSDHIETLYELDIEYAQVLANECGVENIRRAESLNGNPLFSKAL
ADLVCSHIQSNEICSKQLTLCCPLCVNPVCRETKAFFTNQQL
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggctgctgccggccgggcggcgcgacccctggtggcgggcggcaggcagctgagggtc
ccgctgcgctggagggggcaggtggccgcggcagcgcccagcaccaagccgcaggccgag
ccagaaacgcggaaacctaaaacggggatcttgatgttaaacatgggaggtccagaaagg
ctggatgatgtgcatgacttcttgctgcgcctcttcctggaccgggacctcatgacgctt
ccagcacaaaataaacttgcaccgttcatcgctaaacgccgcacaccacgaattcaggag
cagtacagcaggattggaggggggtcacccatcaagaagtggacggcggtgcagggagaa
ggcatggtgaaactgctggacagcatgtctcctcagaccgcaccccacaagtactacatt
ggcttccggtacgtgcaccctctgacagaggaagcaattgaggagatggaggatgacggc
atcgagagagccatcgccttcacgcagtacccgcagtacagctgctccaccacaggaagc
agcttaaatgccatttatcgctactacaataaaaaggggaagaagccaaagatgaagtgg
agtatcattgaccgatggcccacacaccccctgctcatccagtgctttgccgatcacata
cagaaggagctggacctgttcccacctgacaaaaggaaagatgtcgtcatccttttctca
gcccactcgctccccatgtctgtggtgaaccgtggtgatccgtatccacaagaagtggga
gctactgtccagagagtcatggagaagctgaaccactccaacccctaccggctggtctgg
cagtccaaggttgggccaatgccttggcttgttccacaaacagacgagacgattaaagga
ctgtgccaaagaggaaagaagaacatgttgttggtccccatagcatttacaagtgaccac
attgaaacgctttacgaactggatattgagtatgcccaagttttagcaaacgagtgtggc
gttgagaacatcagaagagcggagtcacttaatggaaacccactgttctccaaggctctg
gcagacttggtctgctcacacatccagtccaatgagatctgctccaagcagctgacgctc
tgctgcccgctctgcgtgaatcctgtctgcagggagaccaaagccttcttcaccaaccaa
cagctgtga

DBGET integrated database retrieval system