KEGG   Gallus gallus (chicken): 374021
Entry
374021            CDS       T01006                                 

Gene name
RNF111
Definition
(RefSeq) E3 ubiquitin-protein ligase Arkadia
  KO
K10635  E3 ubiquitin-protein ligase Arkadia [EC:2.3.2.27]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    374021 (RNF111)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     374021 (RNF111)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    374021 (RNF111)
SSDB
Motif
Pfam: RNF111_N zf-RING_2 zf-C3HC4_2 zf-RING_11 zf-rbx1 zf-C3HC4_3 zf-C3HC4 zf-RING_5 Prok-RING_4 zf-ANAPC11
Other DBs
NCBI-GeneID: 374021
NCBI-ProteinID: NP_001186680
CGNC: 3061
Ensembl: ENSGALG00000004171
UniProt: F1P2A5
Position
10
AA seq 985 aa
MSKWTPECNIVYTLKADMKSEVPSDAPKRQESLKGILLNPEPIGAAKSFPAEVEMIASKV
GNEFSHLCSDSQKQKDMNGNRTDQDKSLVVRKKRKSQQAGPSYTQNCPDKENQGVLGLRQ
HLETQSEDNDSSFSDCISSPSSSLHFGDSDTVTSDEEKDAPIRHSQAVLNATSRTHSARS
QKWPRTEADSVPGLLMKRPCFHSSSLRRLPYRKRFVKTSSSQRTQNQKERILMQRKKREV
LARRKYALLPSSSSSSENDLSSESSSSSSTEGEEDLFVSPGENHQNNTAVPSGSIDEDVV
VIEASSTPQVTANEEINVTSTDSEVEIVTVGESYRSRSTLGHSRSQWGQSTSTHAARPQE
QRNRSRISTVIQPLRQNAAEVVDLTVDEDEPTVVPTTSARVEPQVVSSASSNSSSTSTSE
QASDAASNVSTSQPSAAPETTSSLPNSSTAGTSAGDDTRRTASNTTLETGPPAMPRLPSC
CPQHSPCGGSSQNHHALGHPHTSCFQQHGHHFQHHHHHHHNPHPAVPLSPSFSDSNCPVE
RPPPVPAPCGASSSSGTSYHDQQALPVDLSSNGIRSHGSGAFHGTSAFDPCCPGSSSRTA
IYGHQTGAGPSQSLTIDGYGSSMVAQPQPQPPPQASLSSCRHYMHSPYASLTRPLHHQAS
ACPHSHGNPPPQPQPPPQVDYVIPHPVHPFHPSISSHASSHPVPPPPPTHPLANAAAPIP
QHLPAAHQAISHHIPATAPPAQRLHAHEVIQRMEVQRRRMMQHPTRAHERPPPHPHRMHP
NYGHGHHIHVPQTMSSHPRQAPERSAWELGIEAGVTAATYPPGPLHPHLAHYHAPPRLHH
LQIGALPLMVPDMAGYPHIRYISSGLDGTSFRGPFRGNFEELIHLEERLGNVNRGATQGT
IERCTYPHKYKKRKLHCKQDGEEGTEEDTEEKCTICLSILEEGEDVRRLPCMHLFHQVCV
DQWLITNKKCPICRVDIEAQLPSES
NT seq 2958 nt   +upstreamnt  +downstreamnt
atgtctaaatggactcctgaatgtaatatagtttatactctaaaagcggatatgaagagt
gaagttccttctgatgcaccaaagagacaggagagcctgaaggggatcctcttgaaccct
gagcctattggggcagccaaaagcttccctgcagaagtggagatgattgccagtaaagta
gggaatgagttctctcacttatgcagtgactctcagaagcagaaggatatgaatggcaac
cgtacagaccaagacaaaagtctcgtggtgcgaaaaaagcgcaagagccagcaggctggt
ccttcatacacacagaactgtcctgataaagaaaaccaaggagtcttgggattaagacag
catctagaaacacagagtgaagacaatgactcttcttttagtgactgtatctcttcgcct
tcatctagcctgcattttggagactctgacacagtaacgtctgatgaagaaaaagatgct
cccataagacactctcaggcagtgctgaatgctacgagtagaactcacagtgcaaggtca
cagaagtggcctcggactgaggcagactctgttcctggattattaatgaaaagaccctgt
tttcacagcagttctttaagaagacttccgtatagaaagagatttgtgaaaaccagttcc
tcacagcggacacagaatcagaaggagcgaattttaatgcagaggaaaaaaagggaggtg
ttagctcgaagaaagtatgctttgctacccagctctagcagttcgagtgagaatgatctc
agtagtgaatcttcctctagttcatccactgaaggggaggaagacttatttgtgtcacct
ggcgaaaaccaccagaacaatacagctgttccttcaggaagtattgatgaagatgttgtg
gtgattgaagcatcttccacaccccaggtcactgctaatgaagaaataaatgttacctca
acagacagtgaagtggagattgttaccgttggtgagagctacaggtctcgttcaactctt
ggacactcaagatcacagtggggacaaagcactagtactcatgctgcacggcctcaagaa
cagcggaaccgcagcaggatttccacagtcatacagccactgagacagaatgcagcagag
gtagtggaccttacggtggatgaagatgagccaacagttgtgccaaccacatcagctaga
gtggagccccaggtcgtgagttctgcttccagtaacagttctagtacgtctacctcagag
caggcctctgatgcagcttcaaacgtctccaccagccagccctctgcagcaccagagaca
acttctagtcttcccaatagcagcactgctggtacttcggctggagatgatacaagaaga
actgcatctaatacgacactggaaactggccctccagccatgccaaggttaccatcctgc
tgccctcagcattctccatgtggaggatcttcacagaatcatcatgcgttggggcatcca
catacaagctgctttcagcagcatggccaccactttcaacaccaccaccatcaccaccac
aaccctcacccagcagttcccttgtctccttcattcagtgactccaactgccctgttgaa
cggcctcctccagtgcctgcaccttgtggagcaagcagcagttctggcaccagttaccat
gatcagcaggcattgccagtagacttaagcagcaatggtataagaagtcatggaagtggt
gcttttcatggaacatctgcttttgacccctgctgtcctggttcttcatctcgaactgca
atttatgggcatcagactggtgctggcccaagccaatcactaacaatagatggatatgga
tcaagtatggttgcacagccacagccccaacctcctcctcaggcatcgctttcttcctgt
cggcattatatgcattctccttatgcttctttgaccagacctcttcaccatcaagcttct
gcatgtcctcattctcatggaaatcctcctcctcagccacaacctccacctcaagtagat
tatgttattcctcatccagtgcatcccttccatccttcaatctcctctcatgcatcttct
catcctgttccacctccaccaccaactcatcctttagccaatgcagctgctccgattccc
cagcatcttccagcagcacaccaggctatatcccatcacatccctgcaacagctccgcca
gcgcagagacttcatgctcatgaagtgatccagaggatggaggtccagagaagaagaatg
atgcaacacccaacacgtgctcatgaacgacctcctccgcatcctcacagaatgcatcca
aattatggtcatggacatcacattcatgtgcctcagacaatgtcttcccatcctcgacaa
gctccagagagatctgcctgggaactgggaattgaagctggtgtgactgcggctacttac
cctccagggcccttgcatcctcacttggcccactaccatgcacctcctcgacttcatcac
ttgcaaataggggctcttcctctaatggtaccagacatggcgggctaccctcacatccgt
tacatttcatcgggattggatggaacatcattcagaggccctttcaggggcaattttgag
gagctgattcacttggaggaacgattaggcaatgtaaatcgtggagcgacacagggaact
atagaaagatgcacatatccacataaatacaaaaagaggaaactgcactgcaaacaagat
ggggaggaaggaacagaagaagacacagaggaaaaatgtaccatctgcttgtctatatta
gaggaaggtgaagatgtgaggcgacttccatgtatgcaccttttccaccaagtgtgtgta
gatcagtggttgattactaataagaagtgcccaatttgcagagtggacattgaggcccaa
ctgcctagtgaaagctga

DBGET integrated database retrieval system