KEGG   Gallus gallus (chicken): 374026Help
Entry
374026            CDS       T01006                                 

Gene name
ARNT
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    374026 (ARNT)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    374026 (ARNT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_3 PAS_11 PAS HLH PAS_9 PAS_4 HAUS2
Motif
Other DBs
NCBI-GeneID: 374026
NCBI-ProteinID: NP_989531
CGNC: 49009
Ensembl: ENSGALG00000000751
UniProt: Q98SN3
Position
25
AA seq 805 aa AA seqDB search
MAATAANPEMASDVSSLGAAVGSGNPGAGAQTGGGIVQRAAKRRPGLDFDDDGEGNSKFL
RCDDDPMPNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVGKLREQLSTSENALTEGTKPWC
LSNKDPAAPPESASKGRILDLKTGTVKKEGQQSMRMCMGSRRSFICRMRCGNSSVDAVSV
NRLSFMRNRCRNGLGATKDGEPHYVVVHCTGYIKAWPPAGVSLPDDDPDAGQGSKFCLVA
IGRLQVTSSPNCTDMSNVCQPTEFISRHNTEGIFTFIDHRCVATVGYQPQELLGKDIVDF
CHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNREWLWMRTSSFTFQNPYSDEIEYIIC
TNTNVKNSSQDSRPALSNPMQRPQLGQSVSLPLEMGTAQLPSRQQQQPQQTELEVVPGRE
SLAGYDHAQVPVQPVSAAGPEHSKPLEKAESLFNQERDPRFGEIYGSINADQNKAIPASS
VPANPTLFPQGNAFTPSRPAENFRSSSMVPPVNIIQQQPAAAGRILAQISRHASPAQVSG
SSWAAGTRPAFAAQVASQAVKTRPPSFSMGTFQGTPASFSPMAAPGSTASPSSAAYPNLS
GRSAGFTTDAAQTPTPFQPRAAAEGVGMWPQWQGQHHSTAAGEQHVQQPSQPEAFPDMLT
MLGDQGPNYNNEEFPELNIFPSFSE
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaccgccgccaacccggagatggcatcagatgtctcctcgctgggcgcagcc
gtcggctcagggaaccccggggctggagctcaaactggaggaggcatcgtgcagagagca
gccaagaggcgtcctgggcttgattttgatgatgatggcgaagggaacagtaaattcctc
aggtgtgatgacgacccgatgccaaacgataaggagcgatttgccaggtctgatgatgag
cagagttcagcggataaggagagacttgccagggagaatcacagcgagatcgagcgtagg
cggaggaacaaaatgactgcctacatcaccgagctgtccgacatggtgcccacctgcagc
gccctggcacgcaaaccagacaagctgaccatcttacgcatggccgtgtcccacatgaag
tccctgcgtggcacaggcaacacctccacggatggcacctacaaaccctccttcctcacc
gaccaggagctcaaacacctgatcctggaggcagctgatggctttctgttcatcgtgtcc
tgtgagaccggcagggtggtttacgtctctgactccgtgactcccgtcctcaaccagccc
cagtcggagtggttcggcagcacgctgtacgaccaggtgcacccagatgatgtgggcaag
ctgagggagcagctctccacgtcagagaatgcactgacagaaggaaccaaaccctggtgc
ctttctaacaaggatcctgcagccccccctgagagtgcatctaaaggtcgcatcctggat
ttgaagacaggaactgtgaagaaggaggggcagcagtccatgaggatgtgcatgggctca
cggagatccttcatctgccgcatgaggtgtggcaacagctcggtggatgcagtgtctgta
aatcgtctcagcttcatgaggaatcgctgcaggaacggcttaggtgcaacgaaggatgga
gagcctcactacgtggtggtgcactgcacgggttacatcaaggcctggccccctgcaggt
gtttcactgcctgatgatgacccggatgctggccagggcagcaagttttgcctcgtggct
attggcaggctccaggtcaccagctcgcccaactgtacagacatgagcaatgtttgtcag
ccaacagagttcatctcccggcacaacacggaaggcattttcaccttcatagaccaccgc
tgtgtggctactgttggctaccagccacaggaacttctggggaaagacattgtggatttc
tgccacccagaggaccagcagcttttgcgggacagctttcagcaggtggtgaagttaaaa
ggccaggttctgtcagtcatgttccgattccgatccaaaaaccgggaatggctctggatg
agaaccagctcctttaccttccagaacccctactcggatgaaattgagtacatcatctgt
accaacaccaacgtcaagaactcaagccaggactctcggcctgccctatcaaacccaatg
cagaggccccagctggggcagagtgtcagccttcccctggagatgggcacagcacagctg
ccctcaaggcagcagcagcagccacaacagacagagttggaagtggtcccaggaagagag
agcctggccgggtacgaccacgcacaggttcctgtgcagcccgtgagtgctgctggcccg
gagcacagcaaacctctggagaaggcagagagcctctttaaccaggagagggacccgagg
tttggggagatctacggcagcatcaatgcagaccagaacaaagccattcctgccagctca
gtgcctgccaaccccaccctctttccacagggaaacgctttcacaccatcgcggcccgct
gagaacttcaggagcagcagcatggtgcctccagtgaacatcatccagcagcagccggca
gcagcaggccggatcctggcgcagatctcacgccacgccagcccggctcaggtcagcggg
agcagttgggctgccgggacccgaccggcgttcgcagcccaggtggcctcccaggcagtg
aagactcggcctccttcgttcagcatggggacgttccagggcaccccggcctccttcagc
cccatggcagctccaggctccacagcttcccccagcagtgccgcgtacccaaacctctct
ggccgcagtgcgggcttcaccacggatgcagcgcagacccccaccccgttccaaccccgg
gcagcagctgaaggagtggggatgtggccgcagtggcaaggacagcaccacagcacggcg
gccggggagcagcacgtgcagcagcccagccagcctgaggccttcccagacatgctgacc
atgctgggagaccaaggccccaactacaacaacgaggagttccccgaattgaacatattc
ccttctttttcagagtaa

DBGET integrated database retrieval system