KEGG   Gallus gallus (chicken): 374029
Entry
374029            CDS       T01006                                 

Gene name
CLDN3
Definition
(RefSeq) claudin-3
  KO
K06087  claudin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04514  Cell adhesion molecules
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    374029 (CLDN3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    374029 (CLDN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    374029 (CLDN3)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   374029 (CLDN3)
  Exosomal proteins of colorectal cancer cells
   374029 (CLDN3)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37 DUF872 DUF4064
Other DBs
NCBI-GeneID: 374029
NCBI-ProteinID: NP_989533
CGNC: 49012
Ensembl: ENSGALG00000022557
UniProt: Q98SR2
Position
19
AA seq 214 aa
MSMGLEIGGVALSVLGWLCSIICCALPMWRVTAFIGNNIVTAQIIWEGLWMNCVVQSTGQ
MQCKVYDSMLALPQDLQAARALLVVAIVLAVLGLMVAIVGAQCTRCVEDETTKAKITIVS
GVIFLLSGIMTLIPVSWSANTIIRDFYNPLVIDAQKRELGTSLYVGWAASALLLFGGALL
CCSCPPKDERYAPSKVAYSAPRSAVTSYDKRNYV
NT seq 645 nt   +upstreamnt  +downstreamnt
atgtctatggggctggagatcggtggggtggccctgtcggtgctgggctggctgtgcagc
atcatctgctgcgcgctgcccatgtggagggtgacggccttcatcggcaacaacatcgtg
acggcgcagatcatctgggaagggctgtggatgaactgcgtggtgcagagcacggggcag
atgcagtgcaaggtgtacgactccatgctggccctgccgcaggacctgcaggccgcccgc
gcgctgctggtggtggccatcgtgctggccgtgctgggcctgatggtggccatcgtgggc
gcccagtgcacgcgctgcgtggaggacgagaccaccaaggccaagatcaccatcgtctcc
ggcgtcatcttcctgctctccggcatcatgaccctcatccccgtctcctggtcggccaac
accatcatccgggatttctacaacccgctggtgatcgacgctcagaagcgggagctgggc
acgtccctctacgtgggctgggcggcctccgcgctgctgctctttgggggggccctgctg
tgctgctcctgcccccccaaagacgagaggtacgcgcccagcaaggtggcttactccgcc
ccgcgctctgccgttaccagctacgacaagaggaactatgtgtga

DBGET integrated database retrieval system