KEGG   Gallus gallus (chicken): 374031Help
Entry
374031            CDS       T01006                                 

Gene name
NOTCH2
Definition
(RefSeq) neurogenic locus notch homolog protein 2 precursor
  KO
K20994  Notch 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    374031 (NOTCH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA Ank_2 EGF_2 Ank DUF3454 Notch NOD Ank_5 NODP Ank_3 Ank_4 EGF_3 cEGF
Motif
Other DBs
NCBI-GeneID: 374031
NCBI-ProteinID: NP_001238962
CGNC: 49013
Ensembl: ENSGALG00000002922
UniProt: F1P236
Position
8
AA seq 2432 aa AA seqDB search
MARGAGPAFAALFGLVLAVLSRAEPAAALQCMDDSKPCVNEGKCIPYQNGTGYCKCREGY
LGDYCQYRNPCESNTCKNGGTCETTSLIGKATCKCAPGFTGEDCQYSESHICYVSQPCLN
GGTCHPHSQETYECVCPPGYTGKDCQWIDACTSQPCANGSTCTVSGHKFSCICQSGYTGQ
KCEIDVNECATSGLCHHGGTCINLPGSFRCQCKPGYTGHRCESNYVPCSPSPCMNGGTCH
QTSDFTFECNCLPGFKGSICEKNVDDCPNHNCQNGGICVDGVNTYNCRCPPQWTGQFCTE
DVDECQLQPNACQNGGTCTNHNGGYACVCVNGWSGDDCSKNIDDCFTASCANGSTCIDRV
ASFSCICPEGKAGLLCHLDDACVSNPCQKGALCDTNPVNGHYICTCPQGHKGADCTEDVD
ECAMANSNPCEHAGKCVNTEGSFHCECLKGYTGPRCEMDINECHSNPCQNDATCLDKIGG
FTCLCMPGFKGVHCEEDIDECLSNPCVNNGECLDKVNRFLCVCPPGFSGAVCQIDIDDCS
STPCLNGAKCIDHPNGYECQCATGFTGVLCEENINNCDPDPCHHGECQDGIDSYTCICNP
GYMGAICSEQINECHSNPCLHQGRCIDLVNGYQCNCLPGTSGVNCENNFDDCASNPCVHG
DCIDGINRYNCACKPGFTGPRCNVDIDECASSPCNNGGTCINEVNGFRCVCPEGYHHPHC
QSQADGCLSNPCVHGNCTHIVSGYKCVCDPGWIGDYCSTEGNECKSNPCQNGGTCEDLLN
GYRCTCRKGFKGVNCQVVVAPCSPDPCENSGICQESPDSEGYTCQCAPGWEGERCTVDID
ECLSKPCKNHALCHNIQGSYLCECRPGFTGGDCDSNIDDCLSNPCQNGASCVDGINSFSC
ICLPGFHGDKCQTDTNECLSEPCRNGGTCTHYVNSYTCKCQPGFEGTNCENNIDECTESS
CFNGGTCVDGINSFTCQCPVGFTGPFCLMEINECDSHPCLNKGSCVDSLGKYRCICPLGY
TGKNCQTPMDLCSKSPCKNKGTCFQSGAQTRCDCPSGWTGAYCDVPNVSCQVAASQRGIT
VDQLCQHSGHCLNVGNTHRCQCRVGYTGSYCEEQLDECDSSPCQNGATCRDHLGGYQCEC
VPGYQGVNCEYEVDECQFQPCQNGGTCIDLVNHFRCSCPPGTRGRLCEENVDDCISESGG
PRCFNGGQCIDQIGGYSCLCLPGFAGERCEGDINECLSNPCNPRGSLDCIQLINDYTCIC
RSAFTGRHCESVIDVCPRKPCQNGGTCAVASNMPDGFICQCPPGYSGAKCEFSSHSTCGQ
VKCKKGEQCIHTSSGPRCYCPRLAVGEECQTNTGCASAPCQNGGSCHPRSQPPYYYCQCP
AHAQGSQCEQLVHPSQEPLGCLDSQCAEKARDGYCDEDCNTHACQWDGGDCSLTMEDPWA
NCSSSLRCWMLFNGQCDEFCNTPECLFDNFECQQNSRMCKYDKYCADHYGDGRCDQGCNS
EECGWDGLDCAGDKAERLAEGTLIIVVLMRPDELLRDVRSFLRTLGTLLHTNLRIKLDSQ
GNPMVFPYYGEKSAARSRRSVVVVRKHRELEQEVIGTRVFLEIDNRQCAEDSEQCFHNTE
AAAALLAAQAIKGMLPYPFVSVQSEPLLPPKTQLLYLLAVAALIILLILLLGVMMAKRKR
KHGSLWLPEGFILRRDPSNHKRREPVGEDAVGLKNLSVQIPEGNMADSGPTEHWAGDGGP
QPKRVKTEDQALLPEADEQIDQRQWTQQHLEAADVCGSTSLALTPPQADQEVDVLDVNVR
GPDGCTPLMLASLRVGGSDISEDDEDGEDSSANIITDLIYQGANLQAQTDRTGEMALHLA
ARYSRADAAKRLLDAGADANARDNMGRTPLHAAVAADAQGVFQILIRNRVTDLDARMNDG
TTPLILAARLAVEGMVAELINCQADVNAVDDHGKSALHWAAAVNNVEATLVLLKNGANRD
MQDNKEETPLFLAAREGSFEAAKILLDHFANRDITDHMDRLPRDVAQDRMHHDIVQLLNE
YNVAHSPTGHPGAMLNSALSPVICGPNRSFLNLKHASLSKKSRKPNAKGIMPTNLTKDAK
RRRKKSLSESKGQFSESSVTLSPVDSLESPHAFASEPTSSPVMPSPGVLHSSPSSLLTAP
SVQAAHSMSFSNLHEMQPLGRGSSTVLPSVSQLLSQHRTTPPSSGLGRLRPANVSTEWMN
RMEMNESQYNEMFGMVPPVMHSHPSVSQQSGLVQADAKHLGVSRESLPPIMTFQLVPKGG
INQQALPQQAQSNCAQNMAGPLSSMYQISDLAQLPSASFSMAAIPQQDGQVPQTILPAYH
QFQSSMGKYPTPPSQHSCYSSATERTPSHNRHLQGEHPYLTPSPESPDQWSSSSPHSASD
WSDVATSPGNNQRGPAAAHVPEQQRNNMQVYA
NT seq 7299 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcggagccgggccggcgttcgccgccctcttcggcctggtgctggccgtgctg
agccgcgccgagcccgcggccgctttgcagtgtatggacgattccaagccttgtgttaat
gagggaaaatgcattccttatcagaatggtacaggatattgcaagtgtcgagaaggctat
cttggagactactgccagtacaggaacccctgtgaaagcaatacgtgtaagaatggggga
acctgtgaaaccacgtctctgataggaaaggccacctgcaaatgtgctccagggttcaca
ggagaggactgtcaatactctgaatcacacatctgctatgtgtcccagccctgcctgaat
ggagggacgtgtcatcctcacagccaggaaacatatgagtgtgtctgtcctccaggttac
acaggaaaggactgccagtggattgatgcctgtacctctcaaccttgtgccaatggaagt
acatgtaccgtgtctggacataagttctcctgcatctgtcagtctggctacactggccag
aagtgtgagatagatgtgaacgaatgtgccacgtcaggcctttgtcaccatggtgggacc
tgcatcaatttgcctggttcgttccgatgccagtgtaagccaggctatacagggcatcgc
tgcgagagcaattatgtgccgtgttctccatcaccttgcatgaatggaggaacttgtcat
caaacaagtgacttcacctttgagtgcaactgtctgccaggtttcaaggggagcatctgt
gagaagaacgttgatgactgcccaaatcacaactgccaaaatgggggtatatgtgtggac
ggggtgaacacctacaattgccgctgcccgccgcagtggacaggccagttttgcactgaa
gatgttgacgagtgtcagctgcagccaaacgcttgtcagaacggaggtacctgcaccaac
cacaatggaggctatgcctgtgtctgtgtgaatggctggagtggggatgactgcagtaag
aacattgatgattgcttcacggcctcctgtgctaatggatcgacttgcatcgatcgagtg
gcttcattttcttgcatctgtccagaaggaaaggcaggtcttctgtgccacttggatgat
gcatgtgttagcaatccgtgtcagaagggagctctgtgtgataccaatcctgtgaatgga
cactatatctgcacctgtcctcagggccataaaggagcagactgcactgaggatgtggat
gaatgtgcaatggcaaacagcaatccgtgtgaacacgctgggaaatgtgtaaacacagaa
ggctcttttcactgtgagtgtttgaaggggtacacgggacctcgctgtgaaatggacatc
aacgagtgccattctaatccgtgccaaaacgatgccacctgtctggataaaattggagga
ttcacgtgtctctgcatgccaggttttaaaggtgttcactgtgaagaagatattgatgag
tgtctaagtaatccctgtgtgaacaacggagagtgtcttgataaagtaaaccggttcctc
tgtgtctgtcctcctggattcagtggtgcagtgtgtcagattgatatagatgactgctct
agcacaccgtgtctcaatggagccaagtgcatcgaccatcccaatggctatgagtgccag
tgtgccacaggttttactggtgttttgtgtgaggagaacatcaacaactgtgatcctgat
ccttgccatcacggtgaatgtcaagatgggatcgattcctacacttgtatatgcaatcct
ggctacatgggtgccatatgcagtgagcagatcaatgaatgccacagtaatccttgcctc
catcaagggcgctgcattgacttggtgaatggctaccaatgcaactgtttgccgggcact
tcaggagtgaactgtgagaataactttgatgactgtgcaagtaacccatgcgttcacggg
gactgcattgatggcattaatcgctacaactgtgcttgcaaacctggatttacaggccca
cgttgtaatgtggatattgatgaatgcgcatccagcccctgtaataatggtggaacatgt
ataaatgaagtcaatggctttcgctgtgtatgtcctgaaggttaccatcatcctcactgc
cagtcacaggcagatggctgtcttagtaatccctgtgtacatggcaactgcacgcacatt
gttagtgggtacaaatgtgtctgtgacccaggctggataggagattactgttcaacagaa
gggaacgaatgtaaatcaaacccgtgccaaaacggagggacttgtgaggatctgctgaat
ggatataggtgtacctgcaggaaaggattcaaaggtgtgaactgccaggtagtggttgca
ccatgttcccccgacccttgtgagaactcgggaatttgccaagagtctcctgattccgaa
ggctacacctgccagtgtgcccctggctgggaaggggagaggtgtacagtggatattgat
gaatgtctctcaaagccctgcaaaaatcatgctttgtgccataatattcaaggcagttac
ctgtgtgaatgtcgtccaggcttcactggaggagactgtgacagtaacattgatgactgc
ctgtctaatccctgccaaaatggagcttcatgtgtggatgggataaactctttctcatgc
atttgcctacctggatttcatggagataaatgtcaaacagataccaatgaatgtctgagt
gaaccgtgcaggaatggaggcacgtgcacccactatgtcaacagctacacgtgcaagtgt
cagcctgggtttgagggaaccaactgtgagaacaacatcgatgaatgcaccgagagctct
tgtttcaatggaggtacctgtgtggatggcatcaactcctttacctgccagtgtccagtg
ggctttacggggcccttctgcctcatggaaattaatgagtgtgattcacatccttgcttg
aacaaagggtcttgtgtggacagcctgggcaaataccgatgcatatgtcctttgggttac
acggggaagaactgccagacacctatggatctgtgcagtaagtctccctgtaagaataaa
ggcacatgtttccaaagtggagcccagactcgatgcgactgtccttctggctggactggt
gcttactgcgatgtgcccaatgtctcctgtcaagtggcagcttcacaaaggggaatcaca
gtggatcagctgtgccagcactccggtcattgcctcaatgtgggaaacacacaccgctgt
cagtgccgcgtgggttacactggcagctactgtgaggagcagctggatgagtgtgactcc
agcccgtgccagaatggtgctacctgcagggatcatctgggtggataccagtgcgagtgt
gtgcctggataccagggtgtcaactgtgaatacgaagtggatgagtgccagtttcagccc
tgccagaatggaggaacgtgcatagaccttgtcaaccatttcaggtgttcctgtccaccg
ggcactcggggtcgtctgtgtgaggagaacgtggatgactgcatttcagagtcaggagga
ccccgctgctttaatggggggcagtgcattgaccagattgggggctacagctgcctttgt
ctcccaggcttcgcaggcgagcggtgcgagggggatatcaatgaatgcctctctaatcct
tgtaaccctcgtggaagtctggattgcattcagctgataaatgattacacatgtatctgt
cgtagtgcttttactggtcgtcactgtgagagtgtcatagatgtgtgtccccggaagccc
tgtcagaatggaggcacctgtgctgttgccagcaatatgccggatgggttcatctgccag
tgtcctccgggttattctggagcaaaatgcgagttcagcagccacagtacttgtgggcaa
gtgaaatgcaagaagggcgagcagtgcatccacacatcttctggtccgcgatgctactgc
ccaaggctggctgtgggagaggaatgccagaccaacacaggctgtgccagtgccccctgc
cagaatggtgggagctgccaccctcgttctcagcctccgtactattattgtcagtgccct
gctcacgcccaaggcagccagtgtgaacagctcgtacatcccagccaagagcctctggga
tgtttggattcccagtgtgcggaaaaagcgagagatggctattgtgatgaggactgtaac
actcacgcctgccagtgggatggaggcgactgttccctgacaatggaggatccttgggcc
aactgctcctcttcactgcgctgctggatgcttttcaatggacagtgtgacgagttctgc
aacacacccgagtgcttgtttgacaactttgaatgccagcaaaatagcagaatgtgcaag
tatgacaagtactgtgctgatcactatggagacggccgctgtgaccagggctgtaatagt
gaggagtgtggctgggacggtcttgactgtgctggtgacaaagctgagaggctggcagag
gggaccctaatcattgtggtcttgatgcgccctgatgagctgctgcgtgatgttcgcagc
ttcttgcgtactttgggaactctcctccacaccaatctgagaatcaagctggactcccag
ggaaatcccatggtattcccatactatggagagaaatcggcagcacggagccggcgatcc
gttgtggttgttcgcaagcacagagaactagagcaagaggtcattggcacgagggtgttc
ctagagattgacaaccgtcagtgtgcagaagattcagagcaatgctttcacaacacagaa
gctgctgcagccctcttagctgctcaggcaatcaagggcatgttgccttatccttttgtg
tctgtccaaagcgaacccttgttaccaccgaagacccagttgctctacctactcgccgtg
gcagctctgatcatcctcttgattcttctcttgggtgtgatgatggcaaagcgtaagcgc
aagcacggttccctgtggctcccggagggctttattctgcgcagggatcccagtaatcat
aagcgcagggagccagttggagaagatgcagttggactcaaaaatctatcagtccagata
ccagagggtaacatggcagattctggaccaactgaacactgggcaggtgatggtggacct
cagccaaagagggtaaagactgaggaccaggccttgctcccagaagctgatgagcagata
gatcagcgccagtggacacagcagcacttggaagcagcagatgtctgtgggagcacatca
ctagcccttacaccacctcaagcagatcaagaagtagatgttctggatgtcaatgtcaga
ggaccagatggatgtactccacttatgttggcatctctgcgtgtgggcggttccgatatc
agtgaggatgatgaagatggagaagattcctcagcgaacataataacagatctgatctat
caaggtgccaacctgcaggcccaaacagaccgcactggggagatggccctgcacttagct
gcccgttactcgagggcagatgctgcaaaacgtttgctggatgccggtgcggatgccaat
gcacgggacaacatgggacggactcctctgcatgcagctgtagctgctgatgcccaggga
gtctttcagatcttgatccgtaacagagtgacggacttggatgctcgcatgaatgatgga
acaaccccattaatcctggctgcacggctggctgtggaaggaatggtggcagagctcatt
aattgccaagcagatgtgaacgccgtagatgaccacggtaaatctgctcttcactgggct
gctgctgtcaacaatgtggaagcaacactagtgttactgaaaaatggagccaacagagac
atgcaggataacaaggaggagacaccactcttccttgccgctcgggagggcagttttgaa
gcagccaaaatcttgctggaccattttgccaaccgagacatcacggaccacatggatcgt
ctgccccgagatgtggcccaggaccggatgcaccacgacatcgtgcagcttctcaatgag
tataacgtagcgcacagccccaccgggcaccccggggccatgctgaactctgccctctcc
ccagtcatttgtggcccaaatagatcctttctcaatctgaagcacgcttcgttaagcaag
aagtcacgaaaaccgaatgccaaaggcatcatgcccacaaatctcaccaaagacgcgaag
aggagaaggaagaagtccctcagtgagagcaaagggcagttttcagagagctcggtaacc
ctgtcaccagttgactccctggaatcgccccacgctttcgcatccgaaccgacgtcgtct
cctgtgatgccatcaccaggggtgttacactcatcacccagctcgctgctcaccgctccg
tcggtgcaggctgcgcacagcatgtccttctccaacctccacgagatgcagcccttaggg
cgtgggtccagcaccgtgctcccatcggtcagccagctgctctcgcagcacagaaccacc
cctccaagcagcgggctgggcaggctccggccagccaatgtttccaccgagtggatgaac
cgcatggagatgaacgaatcccagtacaacgagatgttcggcatggtgccgccggtgatg
cattcgcaccccagcgtttctcagcagagcggtttggttcaagcagacgcgaagcacctg
ggagtgtccagggagtctctgccccctatcatgactttccagctggttcccaagggtggc
ataaaccagcaagcactgccacagcaggcccagtccaactgcgctcagaacatggctggc
cctctcagctccatgtaccagatatcggatttagctcagctgcccagtgcctcgttctcc
atggctgccatccctcagcaggacgggcaggtgcctcagacaatcctcccagcctaccac
cagttccagagctcgatggggaagtaccccacgcctccgtcgcagcacagctgttactcc
tcggccacagaacggactcctagccacaaccggcacttacaaggggagcacccatacctg
actccgtcgcctgaatctccagaccagtggtcaagctcctccccgcactctgcttctgac
tggtctgacgtggcaaccagtcctggtaacaaccagcgtgggccggcggccgctcacgtg
ccggagcagcagaggaacaacatgcaggtgtacgcctga

DBGET integrated database retrieval system