KEGG   Gallus gallus (chicken): 374038
Entry
374038            CDS       T01006                                 

Gene name
CBL
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04012  ErbB signaling pathway
gga04120  Ubiquitin mediated proteolysis
gga04144  Endocytosis
gga04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    374038 (CBL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    374038 (CBL)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    374038 (CBL)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    374038 (CBL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    374038 (CBL)
   04121 Ubiquitin system [BR:gga04121]
    374038 (CBL)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     374038 (CBL)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    374038 (CBL)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    374038 (CBL)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-RING_4 zf-C3HC4_4 zf-rbx1
Other DBs
NCBI-GeneID: 374038
NCBI-ProteinID: NP_989539
CGNC: 49015
Ensembl: ENSGALG00000029077
UniProt: Q98TY6
Position
24
AA seq 903 aa
MSAPLKKGPGGLIGLMKDAFQPHHHHLGPHQPGAVDKKMVEKCWKLMDKVVRLCQNPKLA
LKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEG
KERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGE
KTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLR
NWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILR
TIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGS
TFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESEGQGCPFCRCEIKGTEPIVVDPFDP
RGGGGLSRQGAEGTPSPNYDDDDDDRADDSLFMMKELAGTKVERPPSPFSVAPQATLPPV
PPRLDLLQQRVSNPPGASSPSTSSKAAPGTLHKDKPLPIPPTLRDLPPPPPPDRPHSIGA
DARPQRRPLPCTPTDCPARDKPPPVPSNRQGDLWPSRPIPKAPSVAHSPGDHWPGRELSN
RHSLPFSLPSQMDSRPESHRLGSTLSLDNPVNLNTGPPATSECEHPKIKPSSSANAIYSL
AARPLPVPKLPPGEQSESDEDTEYMSPSSLPVVPPGPAVQKPEIKMPLEMTQSLRVLECD
RQADGCMYEAMYNIHSQAMPSAFETVNTSDEGDLAAATASNGPEESENEEDGYDVPKPPL
PVAIARCTLSDISNATPAFSRMSLENDPVTGFSDGSQVPERPPKPLPRRINSERKAGSCQ
PGAASSNTGASLQLSSEIENLMSQGYSYQDIQKALVIAHNNIEMAKNILREFVSISSPAH
VAT
NT seq 2712 nt   +upstreamnt  +downstreamnt
atgtcggctccgctgaagaagggccccggggggctgatcgggctgatgaaggacgccttc
cagccgcaccaccaccacctcggcccgcaccagcccggcgccgtggacaaaaagatggtg
gagaagtgctggaagctgatggacaaggtggtgcgcctgtgccagaacccaaagctggcc
ctgaagaacagcccgccctacatcctggaccttctgcccgacacctaccagcacctccgg
accatcctgtcccgctacgaggggaagatggagaccttgggagaaaacgagtacttccgt
gtgttcatggagaacctgatgaagaaaaccaagcagaccatcagcctcttcaaggagggg
aaagagcggatgtatgaggagaactctcagcctaggcgtaacctgacgaagttatccctg
atattcagccacatgctggcagaactcaaaggtattttcccaagtggccttttccaagga
gacacattccggatcaccaaagctgatgctgcagaattttggagaaaagcatttggggag
aagaccattgttccctggaagagcttccgccaagccctgcacgaagtgcatcccatcagt
tcagggctggaagccatggccctgaagtcaacgattgacttgacgtgcaatgactacatt
tcagtatttgagtttgatatcttcacacgactctttcagccatggtcctctttgctcagg
aactggaatagcctagcagtgactcatcctggttatatggcattcctaacgtatgatgag
gtgaaagcccggcttcagaaattcattcacaaacctggcagttatatttttcgattgagt
tgcacccgacttggccagtgggccattggatatgtcactgcagatgggaacattcttcgg
acaatccctcacaacaaacctctttttcaagcgttgattgacggcttcagggaaggcttt
tatttatttcctgatggccggaatcagaaccctgacttgactggcttgtgtgagcccaca
cctcaggaccacattaaagttacacaggaacaatatgaattgtactgtgagatgggctcc
acgttccagctgtgtaaaatatgtgctgaaaacgacaaggatgtgaagattgaaccatgt
ggccatctgatgtgcacgtcctgtctcactgcatggcaggaatcagaaggccaaggttgt
cctttttgccgctgtgaaatcaaaggcacggagccaattgttgtagacccattcgacccc
agaggaggaggaggattgtcacggcaaggcgcagaaggaactccctcacccaactatgat
gatgatgacgatgacagagctgatgattccctcttcatgatgaaagaactcgctggtacc
aaagtcgagcgtcctccttccccgttctcagtagctccgcaggccacccttcctcctgtg
ccaccacgactggatcttctgcagcagcgagtgtccaatccacctggggcttccagcccc
agcacctcttcaaaggctgctcctggtacccttcacaaagacaagcctctgcccatccca
cccacgctccgagatctcccgccgccaccgcctccggatagaccgcattccattggggcc
gatgctcggcctcagaggcggcccctgccctgcacaccaacagactgtcctgcaagggac
aaaccaccccccgtgccctccaaccgtcagggggatctttggccctcccggccaattcca
aaagccccgtctgtagctcacagccccggtgaccattggcctgggagagaactgtcaaac
aggcactcgcttcctttctccttgccctctcagatggattccaggcctgaaagccatcgg
cttgggagcacgctcagcctggacaacccagtgaacttgaacactggtccgccagcaacc
tcagaatgtgagcatcccaaaattaaaccctcctcgtctgccaatgctatctactcctta
gctgccagaccactgcctgtaccgaaactgcctcctggggaacagtctgaaagcgatgaa
gacactgaatacatgtcaccctcctctctgccagtggtgcctccaggtcctgctgtacaa
aaaccagagatcaaaatgcctttggaaatgactcagagtttgcgagttctggagtgcgac
cggcaggcggatggctgtatgtatgaagcaatgtacaacattcactcccaagcaatgccc
tctgcttttgagaccgtcaacacttctgatgaaggggatctggcagcagccactgccagc
aacggccctgaggagtcagaaaatgaagaggatggctatgatgtccccaaaccaccacta
ccagttgctattgctcgttgcacactgtctgatatctccaatgccacacctgccttcagc
cgaatgtctttggaaaatgacccagtaacaggtttttcggatggctctcaagttccagaa
aggcctccgaagccgctgccacgaagaatcaactctgagcgcaaagcagggagctgccag
ccaggagcagccagcagcaacaccggggcgtcactgcagctctccagcgagattgagaac
ctcatgagccaaggctactcatatcaggacattcagaaagctctggtcattgcacataac
aatattgaaatggccaagaatattctccgtgagtttgtttccatttcctcccctgcacac
gtggccacatag

DBGET integrated database retrieval system