KEGG   Gallus gallus (chicken): 374048
Entry
374048            CDS       T01006                                 

Gene name
MYOD1
Definition
(RefSeq) myoblast determination protein 1 homolog
  KO
K09064  myogenic factor 3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    374048 (MYOD1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Myogenic transcription factors
    374048 (MYOD1)
SSDB
Motif
Pfam: Basic Myf5 HLH
Other DBs
NCBI-GeneID: 374048
NCBI-ProteinID: NP_989545
CGNC: 4667
Ensembl: ENSGALG00000006216
UniProt: P16075
Position
5
AA seq 299 aa
MDLLGPMEMTEGSLCSFTAADDFYDDPCFNTSDMHFFEDLDPRLVHVGGLLKAEEHPHHH
GHHHGNPHEEEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEA
FETLKRCTSTNPNQRLPKVEILRNAIRYIESLQALLREQEDAYYPVLEHYSGESDASSPR
SNCSDGMMEYSGPPCSSRRRNSYDSSYYTESPNDPKHGKSSVVSSLDCLSSIVERISTDN
STCPILPPAEAVAEGSPCSPQEGGNLSDSGAQIPSPTNCTPLPQESSSSSSSNPIYQVL
NT seq 900 nt   +upstreamnt  +downstreamnt
atggacttactgggccccatggaaatgacggagggctccctctgctccttcacggccgcc
gatgacttctatgacgacccgtgcttcaacacgtcggacatgcacttcttcgaggacctg
gacccccggctggtgcacgtgggcgggctgctgaaagccgaggagcacccgcaccaccac
gggcaccaccacgggaacccacacgaggaggagcacgtgcgggcgcccagtgggcaccac
caggccggccgctgcctgctgtgggcgtgcaaggcctgcaagaggaagaccaccaacgct
gaccgccgcaaagccgccaccatgagggaacggcggcggctcagcaaggtcaacgaggcc
tttgagaccctcaagcgctgcacttccaccaaccccaaccagcgcctgcccaaggtggag
atcctgcgcaacgccatccgctacatcgagagcctgcaggccctgctgcgtgagcaggag
gatgcatactacccagtgctggagcactacagcggggagtcagatgcctccagccctcgc
tccaactgctccgacggcatgatggagtacagcgggccgccctgtagctctcgcaggaga
aacagctacgacagcagctactacacggaatcaccaaatgacccaaagcatgggaagagt
tctgttgtttccagcctcgactgcctctcaagcattgtggagaggatttccacagacaac
tccacatgtcccatactgcctccagctgaagctgtagctgaagggagtccctgttccccc
caggaaggaggaaacctgagtgacagtggagcccagattccttcccccaccaactgcacc
cctcttccccaggaaagcagcagcagcagcagcagcaatccaatctaccaagtgctataa

DBGET integrated database retrieval system