KEGG   Gallus gallus (chicken): 374051
Entry
374051            CDS       T01006                                 

Gene name
HOXA1
Definition
(RefSeq) homeobox protein Hox-A1
  KO
K09301  homeobox protein HoxA/B/D1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    374051 (HOXA1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    374051 (HOXA1)
SSDB
Motif
Pfam: Homeodomain YcgR Homeobox_KN
Other DBs
NCBI-GeneID: 374051
NCBI-ProteinID: XP_003640745
CGNC: 49021
Ensembl: ENSGALG00000028095
UniProt: R4GHI8
Position
2
AA seq 320 aa
MSSFLEYPVLGGEAGACAARSYHPEHGITTFQPCAVSAGSCSGEDRFLVGRGVSLSPHRH
HHPPAQPAAYQHHGGLGVSYAHPGCPPTYGAQGFGAAYGPYALGQDAELGGGFPPCAPAV
YSGSLSSAAAQHPHQGYAGGPAQYVPSPYGQEQQSLPLGTYNHALSPLHAGHQDNSRSPS
ADTSPPAQTFDWMKVKRNPPKTGKAGEYGFVGQPNTVRTNFTTKQLTELEKEFHFNKYLT
RARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPTGCEEKADDPSEKCC
PSPCSASPASCASDPGPAAN
NT seq 963 nt   +upstreamnt  +downstreamnt
atgagctccttcctcgagtaccccgtcctcggcggcgaggcgggggcctgcgccgcccgc
tcctaccaccccgagcacgggattacaacttttcagccctgcgccgtcagcgccggcagc
tgcagcggggaggaccgcttcctcgtgggccgcggggtgtccctcagcccccaccggcac
caccaccccccggcccagcccgccgcctaccagcaccacggcggcctgggggtgtcctac
gcgcaccccggctgccccccgacgtacggcgcgcagggcttcggcgccgcctacggcccc
tacgctctggggcaggacgcggagctgggcggcggcttccccccctgcgcgcccgccgtc
tactcgggcagcctctcctccgccgcagcgcagcacccgcaccagggctacgcggggggg
cccgcgcagtacgtgccctccccgtacgggcaggagcagcagagcctgcccctgggcacc
tacaaccatgccctgtctcccctccacgccggccaccaggacaactcccgctccccctcc
gccgacacctcgccgccggcgcagaccttcgactggatgaaagttaaaaggaacccccct
aaaacaggcaaggccggcgagtacggcttcgtggggcagcccaacaccgtccggaccaac
ttcaccaccaagcagctcaccgagctggagaaggagttccacttcaacaagtacctgacc
cgggccaggcgggtggaaatcgccgcctccctccagctcaacgagacgcaggtgaagatc
tggttccagaaccggcggatgaagcagaagaagagggagaaagaggggctgctgcccatc
tcccccgccacccccacgggctgcgaggagaaggcggacgacccgtcggagaagtgctgc
ccgtcgccctgcagcgcctctcccgcatcctgcgcctcggacccgggacccgccgccaac
tga

DBGET integrated database retrieval system