KEGG   Gallus gallus (chicken): 374052
Entry
374052            CDS       T01006                                 

Symbol
F5
Name
(RefSeq) coagulation factor V isoform X1
  KO
K03902  coagulation factor V (labile factor)
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: F5_F8_type_C Cu-oxidase_3 Cu-oxidase_2 DUF2271
Other DBs
NCBI-GeneID: 374052
NCBI-ProteinID: XP_001231901
CGNC: 11315
Ensembl: ENSGALG00000029298
UniProt: A0A1D5P5L2
Position
1
AA seq 2025 aa
MTHPQSVGGLKQLLLGARLFLKMMWRRGVKVVYTVLFFFFFISTGSLSAGEEEVKSSDLS
VANSVTLLRQDYFISEGKLEAATAIKAAVSASSSRAAYAGIHTMALHCVHLFLLLLLSSW
WPDSEKHVVGAVKVREHYIAAQFTVWTYKPESEEKSRLTHLDPVFKKISYREYEVDFKKE
KPADKSTGLLGPTLRAEVGDTLVVHFKNMADKPISIHPQGLVYNKKAEGSLYADRTSHVE
KQDDAVLPGQVYTYVWDITEEVGPREADLPCLTYAYYSHENMVMDFNSGLIGALLICKKG
SLNEDGSQKLFDKEYILMFGVFDENKSWQRSASLKYTINGYADGTLPDLEACMYDNISWH
LIGMSSKPEIFSVHINGQVMEERHHRISTVNLVGGASTTVNMTVSEEGRWLISSLVQKHL
KAKMHGYLTVRDCGDREVKKSRLSLKERRMIKNWEYFIAAEEVVWDYAPTIPDSLDKRYK
AQHLDNYSNLIGKKYKKAIFRQYTDGSFTKRLENPRPKETGILGPIIRAQINDKVKIVFK
NKASRPYSMYFHGVTLSKNAEGADYPQDPTGNATQSKGIQPGKTYTYEWQIAKTDQPTAQ
DAQCITRLYHSAVDIERDIASGLVGPLLICKSEALSQKGVQKKADGEQHAMFAVFDENKS
WYIEDNIKDYCSNPASVRRDDPKFYNSNIMHTINGYVSDRNEILGFCQDNVVQWHFSSVG
TQDEVVSIRLSGHAFLYRGKYEDVLNLFPMSGESVTVEMDNIGTWLLASWGATEMSYGMR
LRFRDVRCDYEDDNLFDVVDFTNTKTDKKALSTSVEEDVEEEAEDDDSEYQDLLASFYSI
RSLRNTGETEETQNLTAMAWGQDGDIDTASSKLAIDSDLTVTNGSKLTEFLETRIAPPLQ
VETETFQSNYTSVTAEEYLLLASASDGKPDLVFENRSQSDYAVDHSNMSGGEHLLSNGEA
HVKDAEEPLTDRKDSNFFTEEHQEESAGKRNNSINSKRKKRSPLAVKFYAVQKMKALLDH
VRNKNGSFSDKTNAPNSMQHTENTSSTATVGAGQHPSDYDDDLEEEETKEGNAMHAGNLT
LELEATVEENESNTSRLSQLELSKDKQSDSFSLDQTLGNIRPNSSPALVKNFLEASLPRA
VKYSSKMTDEEWNLVSAKGIQRLEANLDKSVSGKLNYGGRNGTIFLNKKHKKKDGEFSHL
MGEKHKGNHMRSPLKRKEGNKNDTLSISGTFVKIRRKKKEYPKTTQFLNPRSKKPQKFAK
PTEEFGRTLFPGGANHESLPCCNTTESPSKSSHRELPGYTQQLKPSIVIGLPHENGNYEY
TSGEYYTEDTSGDEYEYYYVSFDDPYMTDPKLNVNEQRNPDNIAEHYLRSRGNERRYYIA
AKEVCWNYAGLKKSTMMYDKICKDGSTKKVIFQRYTDSTFTTVQDEGEYEEHLGILGPVI
RAEVNDVILVHFKNLASRPYSLHAHGLFYEKSSEGSIYDDESSDWFKEDDKVQPNSSYIY
VWYANRRSGPLQPGAACRSWVYYSDVNLEKDTHSGLIGPILICEKGTFSASDNNRTNTRD
FFLLFMVFDEEKSWYFDKRSRKPCTEKTQEMQQCHKFYAINGITNNLQGLRMYEGELVRW
HLLNMGVPKDIHVVHFHGQTFIEQLEAKYQLGTYTLLPGSFQTVEMKPQRPGWWLLDTEV
GEYQQAGMQASYLVLEKGCRIPMGMASGVILDSQINASHHIDYWEPKLARLNNSGTYNAW
STTMTEDLPWIQVDFQRQVLLTGIQTQGAKHFLKSFYVQKFFIVYSTDKRKWNTFRGDSS
PAEKIFEGNSDAYGIKENIIDPPIIARYIRVYPKQAYNEPTLRMELLGCEVDACSLPLGM
ENGEIKNTQITASSVKTSWFSTWEPSLARINQKGKINAWRAKSNNNQQWLQIDLLTIKKI
TAIATQGVKSVTTENFVKTYVILYSNQGSEWKSYTEDSSSVAKVFSGNEDSRGHVKHFFN
PPILSRFIRIVPKTWYNGIALRVELFGCDFGGDLTAKRTEKSGSS
NT seq 6078 nt   +upstreamnt  +downstreamnt
atgacccatccacagtctgtaggggggctgaagcagcttctccttggtgcacgtctcttc
ctgaaaatgatgtggaggaggggagtgaaggtagtttacacagtgctttttttttttttt
tttatctctactggatccctgtcagcaggggaggaggaggtgaagagcagtgacctgagt
gtagcgaacagtgttaccctcttgcgtcaggattatttcatttctgaggggaagttagaa
gctgcaacagcaataaaagcagcagtttctgcttcatcttccagagcagcatacgcaggc
attcataccatggcactccactgcgtgcatctttttctcttgcttctgctcagttcatgg
tggccggactcagagaagcacgtggtgggagctgtgaaggtcagggaacactatatagct
gctcagttcactgtttggacctacaaaccggagtctgaggagaagtccagattgacgcat
ttggatcctgtgtttaagaaaatttcttacagagaatatgaagtggattttaaaaaagaa
aaaccagcagataagtctacaggactccttggaccaactctgcgtgccgaagtgggagat
actttagtagttcactttaagaatatggctgacaaacccatcagtattcatccccaaggc
ttagtttacaacaagaaggcagaaggctccctgtatgctgacagaacatcacatgtagaa
aaacaggacgatgctgtgcttccaggccaggtctacacatacgtgtgggatataacagaa
gaagttggtccaagagaagctgaccttccttgtcttacttatgcatattattctcatgag
aacatggtaatggattttaactctggtctgattggagcactgcttatctgcaagaaagga
agcctaaatgaggatgggtcacagaaactttttgacaaggaatatatactaatgtttggc
gtgtttgatgaaaacaagagttggcaaagatcagcatcgcttaaatacacaattaatggg
tatgctgatggaacgttaccagatttagaggcttgtatgtatgacaacattagctggcat
ttgataggaatgagttctaagccagaaattttctccgttcatataaatggccaggtcatg
gaggaaagacatcaccgaatttctactgtaaacctagtgggaggagcatcaaccacagtg
aacatgacagtgagcgaagaaggaaggtggttgatatcttctctggtccagaagcacttg
aaagctaaaatgcatggctaccttactgtaagagactgtggagacagagaggtgaagaag
agtcgtctctcccttaaggaacgtcgcatgatcaagaactgggaatatttcattgctgca
gaggaagtcgtttgggattatgccccaactattccagacagccttgataaacgctataaa
gcccaacatttggacaactactcaaatctaataggtaaaaagtataaaaaggctattttt
agacaatatactgatggcagcttcaccaaacgtctggaaaatcctcgtcccaaggaaact
gggatcttgggtccaattataagagctcagatcaatgataaagttaaaattgtattcaaa
aataaggccagcagaccctacagtatgtacttccatggagtgacgctttcaaagaatgca
gaaggagctgattatcctcaggatcccacaggcaatgccacccagagtaaaggaattcaa
ccagggaagacctacacgtatgaatggcaaattgctaaaacagatcaacctactgcacag
gatgcacaatgcattacccggttgtatcatagtgctgtagatattgagagagacatagcc
tctggactggttggcccacttctgatctgtaaaagtgaagcactttctcagaagggtgtg
cagaaaaaggcagatggggagcagcatgcaatgtttgctgtgtttgatgaaaataagagc
tggtacatagaagacaatatcaaggactactgcagcaaccctgcctctgttagaagggat
gaccccaagttctataactcaaacataatgcacacaataaatggctatgtgtctgacaga
aatgaaatccttggattttgccaagataatgttgttcagtggcacttctccagtgttggc
actcaggacgaggttgtctctattcgcctttctgggcatgctttcctgtacagaggaaaa
tatgaagatgtgttgaaccttttcccgatgagtggagaatcagtcacagtggaaatggac
aatattggcacttggcttttagcatcctggggtgccacagagatgagttatggcatgaga
ctgagattcagagatgtcagatgtgactatgaggatgataacttgtttgatgttgtggat
ttcacaaacaccaagactgacaaaaaggctctttccacctcagttgaagaagatgtggaa
gaagaagcagaggacgatgattcagaatatcaggatctgctggcttctttttactccatc
cgaagtttaagaaatacaggagaaactgaagaaactcaaaaccttacagcaatggcctgg
ggacaggatggagacattgatactgcaagttctaagttggctattgactcagatctgaca
gttaccaatggtagtaaattgacagagttcttagaaactcgtattgctcctcctctccaa
gttgagactgaaacattccagtcaaattatacatcagtcacagcagaagagtacttactt
ttagctagtgcaagcgatggaaagcctgacttagtttttgagaatagaagccaaagcgat
tatgcagtagatcacagtaatatgtctggaggtgagcacttgctgagcaatggagaagcc
cacgtgaaagatgcagaagagcctctgactgatagaaaagacagtaatttttttactgaa
gaacatcaagaagaaagtgcagggaaaagaaataacagcattaatagtaaaaggaaaaag
cgaagcccattggctgttaaattttatgcagtccaaaagatgaaagcccttctagatcat
gtaagaaataaaaatggctcattttctgacaagacaaatgcacctaattccatgcagcat
acagagaacacatccagcacagccacagtgggagctggccagcatccaagtgactatgat
gatgatctggaagaggaagaaacaaaggagggcaatgccatgcatgcaggtaatttgaca
cttgaattggaagccactgtagaagaaaatgagtctaatacatcccgcctctctcaactt
gagctatccaaagataaacaatcagattcattttctttagatcaaacattgggcaacata
agacccaattcaagccctgcattagtgaagaactttctggaagcatcattgcccagggct
gtgaagtactcatctaaaatgacagatgaagaatggaatttggtgtctgcaaaggggatt
cagagactggaggcaaacttagacaaatctgttagtggtaagttgaattatggaggcagg
aatggtacaatattcctaaataagaagcataagaagaaggatggagaattctcacatcta
atgggagaaaaacataaaggcaaccatatgcgctcacctctgaaaagaaaggaagggaac
aagaatgatactttgagtatatctggaacctttgtcaagatccgaaggaaaaaaaaggaa
tatccaaaaactactcaatttttgaacccaaggagtaaaaagccccagaaattcgccaaa
cctactgaagagtttggccgcacattgtttccaggtggggccaaccatgaatcactgccg
tgttgcaataccacagagtcacccagtaagtccagccacagagaactgccaggttataca
caacagctgaagccatccattgtcattgggcttcctcatgaaaatggaaactatgaatac
acttcaggagaatattacactgaggatacatcaggtgatgaatatgaatactattatgtg
agctttgatgatccatacatgacagacccaaaactaaatgtcaatgaacagcgtaaccca
gacaacattgctgaacattacctgcgtagcagagggaatgagaggagatactacattgca
gctaaggaagtctgctggaactatgcaggacttaaaaaaagtacgatgatgtatgacaaa
atctgtaaagatggcagcacaaaaaaggtgatttttcaaaggtacacagacagtaccttt
acgactgttcaggatgaaggcgaatatgaagaacatcttggcatcctgggaccggttatc
cgggctgaagtgaatgatgtaatcctggttcattttaagaatctggcatctagaccatat
tcccttcatgcccatggacttttttatgaaaagtcctctgagggaagcatttatgatgat
gagtctagtgattggtttaaggaagatgataaagttcagccaaatagcagctatatatat
gtatggtatgcaaacaggcgatcaggaccactacagccaggagcagcttgtcgttcctgg
gtctactactccgatgtaaatctggagaaagatacgcactcgggtttgattgggccaata
ctgatctgtgaaaaaggaaccttcagtgcatcagacaacaacagaacaaacactcgagac
tttttcttgctttttatggtctttgatgaagaaaaaagttggtacttcgacaaacgctct
agaaagccttgtactgagaagacccaagaaatgcaacaatgccacaaattctatgccatt
aatggtattaccaacaatttgcaaggcctaaggatgtatgaaggtgaactcgtccgatgg
catttgcttaatatgggagtgccaaaagacattcatgttgttcattttcatggacagaca
ttcatagaacagctagaggcaaagtatcagcttggtacatacacactccttccaggctca
tttcagacagttgaaatgaaaccacagagacctggctggtggcttttagacactgaagtg
ggggaatatcagcaagcaggaatgcaggcatcctatttggttctggagaaaggctgcagg
attccaatgggtatggcaagtggagttatacttgattcacaaatcaatgcttcacatcat
atagactactgggaacctaagctagcccgattaaacaattctggaacatacaatgcttgg
agtacaacaatgacagaggatctcccttggattcaggtggactttcaaagacaagttcta
ttaactggaatacagacgcagggtgccaagcattttttaaagtccttctatgtccagaag
ttctttattgtttacagcacagacaaacgaaagtggaacactttcagaggagacagctcg
ccagcagaaaagatttttgaaggtaattctgatgcctatggtataaaagagaacatcatt
gatccccctataattgcaagatatatcagagtctacccaaaacaggcctacaatgaacct
actcttcgcatggagctccttggctgtgaagtagatgcttgctctttgccacttggaatg
gaaaatggagagatcaagaatactcagataacagcctcatctgttaagacatcctggttt
agcacctgggagccttcccttgcccgtatcaatcagaaaggaaagataaatgcctggcga
gccaagtcaaacaacaaccaacagtggctgcaaattgatctcctcacaattaagaagata
actgctattgctacgcagggggtcaagtctgtaacaaccgaaaactttgtgaaaacctat
gttattctctacagcaaccaaggctcggagtggaaatcctatacagaggattcaagctca
gtggcaaaggttttctctggtaatgaagacagcagggggcacgtcaagcatttcttcaac
ccacctatcctgtccaggtttatccgcattgttccaaaaacatggtataatggtattgcc
cttcgggtggaactttttggctgtgattttggtggggatctgactgcaaaaagaacagag
aagtctgggagctcttaa

DBGET integrated database retrieval system