KEGG   Gallus gallus (chicken): 374059
Entry
374059            CDS       T01006                                 
Symbol
FZD8
Name
(RefSeq) LOW QUALITY PROTEIN: frizzled-8
  KO
K02375  frizzled 5/8
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
gga04310  Wnt signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    374059 (FZD8)
   04150 mTOR signaling pathway
    374059 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    374059 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    374059 (FZD8)
G protein-coupled receptors [BR:gga04030]
 Frizzled / Smoothened family
  374059 (FZD8)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 374059
NCBI-ProteinID: XP_418566
CGNC: 49026
Position
2:12842879..12846039
AA seq 670 aa
MEWSYLLAVTPLLAALALLQRAGCAAASAAAAASSSSSSSAKELSCQEITVPLCKGIGYN
YTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSSDLRFFLCSMYTPICLEDYKKPLPPCRS
VCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGSPDTLCMDYNRTDLTTAAPPPAKPPLR
GARPGGPARAPPPAAAAPPAEAPRPPPPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIAN
CALPCHNPYFSPDERAFTAFWIGLWSVLCFLSTFATVSTFLIDMERFKYPXRPIIFLAAC
YLFVSLGYLVRLVAGHEKVACSGGAGAGGAGPGAAGAGGGAAAAGAAAGGRGAAGGAAEL
QPELAVAEHVRYESTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAG
YAQYFHLAAWLLPSVKSIAVLALSSVDGDPVAGICYVGNQSLENLRGFVLAPLLIYLAIG
SMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAASVVACLFYEQH
NRPRWEATHNCPCLRDQQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRAL
CTRCCWASKGAAVAGGAGAGAGGQTAIAAAGGLGAGGGGSLYSDVSTGLTWRSGTASSVS
YPKQMPLSQV
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggagtggagctacctgttggccgtcaccccgctgctcgccgccctggccctgctgcag
cgcgccggctgtgccgccgcctcggccgccgccgccgcgtcgtcgtcgtcttcgtcgtcg
gctaaggagctgtcgtgccaggagatcaccgtgccgctctgcaagggcatcggctataac
tacacctacatgcccaaccagttcaaccacgacacgcaggacgaggccgggctggaggtg
caccagttctggccgctggtggagatccagtgctccagcgacctgcgcttcttcctctgc
agcatgtacacccccatctgcctggaggactacaagaagccgctgccgccctgccgcagc
gtctgcgagcgggccaaggcgggctgcgcgccgctcatgcgccagtacggcttcgcctgg
cccgacaggatgcgctgcgaccggctgccggagcagggcagccccgacacgctctgcatg
gactacaaccgcaccgacctcaccacggccgcgccgccgcccgccaagccccccctccgc
ggcgcccggcccggcggccccgccagggcgccccccccggccgccgccgcgcccccggcc
gaggccccgcgcccgccgccgccctgcgagccgggctgccagtgccgcgcgcccatggtg
tcggtgtccagcgagcggcacccgctgtacaaccgcgtgaagacggggcagatcgccaac
tgcgcgctgccgtgccacaacccctacttcagccccgacgagcgcgccttcaccgccttc
tggatcggcctgtggtccgtgctctgcttcctctccaccttcgccaccgtctccaccttc
ctcatcgacatggagcgcttcaagtacccgnagcggcccatcatcttcctggccgcctgc
tacctcttcgtctcgctgggctacctggtgcgcctggtggccggccacgagaaggtggcg
tgcagcggcggcgcgggggcgggaggcgcggggcccggcgcggcgggggcgggcggcggc
gcggcggcggcgggggcggcggcgggggggcgcggggcggcgggcggcgcggccgagctg
cagcccgagctggcggtggccgagcacgtgcgctacgagagcacggggccggcgctgtgt
accgtggtgttcctgctcgtctacttcttcggcatggccagctccatctggtgggtcatc
ctctcgctcacctggttcctggccgccggcatgaagtggggcaacgaggccatcgccggc
tacgcgcagtacttccacctggccgcctggctgctccccagcgtcaagtccatcgccgtg
ctggcgctcagctccgtggacggggacccggtggccggcatctgctacgtgggcaaccag
agcctggagaacctgcggggcttcgtgctggcgccgctgctcatctacctggccatcggc
tctatgttcctgctcgccggcttcgtctcgctcttccgcatccgcagcgtcatcaagcag
cagggcggccccaccaagacccacaagctggagaagctgatgatacgcctgggcctcttc
accgtgctttacaccgtgccggccgccagcgtggtcgcctgcctcttctacgagcagcac
aaccggcctcgctgggaggccacgcacaactgcccctgtctgcgtgaccagcagcccgac
caggcccgccgccccgactacgccgtcttcatgctcaagtacttcatgtgcctggtggtg
ggcatcacctccggcgtctgggtctggtccggcaagaccctcgagtcctggagggccctc
tgcacccgctgctgctgggccagcaaaggtgctgccgtggccgggggtgctggagcagga
gcgggcgggcagaccgctatcgctgctgctggaggacttggggctggtggaggcggctcc
ctgtacagcgatgtcagcaccggcctgacgtggaggtctggcactgccagctccgtctcc
taccccaagcagatgcctctgtctcaagtgtga

DBGET integrated database retrieval system