KEGG   Gallus gallus (chicken): 374060Help
Entry
374060            CDS       T01006                                 

Gene name
FZD7
Definition
(RefSeq) frizzled-7 precursor
  KO
K02432  frizzled 1/7
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
gga04310  Wnt signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    374060 (FZD7)
   04150 mTOR signaling pathway
    374060 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    374060 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    374060 (FZD7)
G protein-coupled receptors [BR:gga04030]
 Frizzled / Smoothened family
  374060 (FZD7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz
Motif
Other DBs
NCBI-GeneID: 374060
NCBI-ProteinID: NP_989552
CGNC: 49027
UniProt: O57329
Position
7
AA seq 567 aa AA seqDB search
MRPAAGEAGAGLRWLGLAALLAALLGTPCAAAHQDDKAISVPDHGFCQPISIPLCTDIAY
NQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQAIPPCRS
LCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDAPPGPGGAGGRGATA
QPTAGYLPDLLTPPQPAAGFSFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRPNGLMYFK
EAEVRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAYAAG
FLLEERVVCLERFSEDGYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLAAG
MKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDVLSGVCYVGIYSVDSLRGFVL
APLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVL
ACYFYEQAFRSTWEKTWLLQTCKTYAVPCPSHFAPMSPDFTVFMIKYLMTMIVGITTGFW
IWSGKTLQSWRRFYHRLSTGSKGETAV
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccgcggcgggagaagcgggcgccgggctccgctggctgggcctggccgccctg
ctggccgccctgctgggcaccccgtgcgcggcggcgcatcaggacgataaggccatctcc
gtgccggaccacggcttctgccagcccatctccatccctctctgcacggatatcgcctac
aaccagaccatcctgcccaacctgctgggccacaccaaccaggaggacgcaggcctggag
gtgcaccagttctacccgctggtcaaggtgcagtgctcggccgagctcaagttcttcctc
tgctccatgtacgcaccggtttgcaccgtactggagcaggccatcccaccctgccgctcc
ctatgtgagcgggctcgccagggttgtgaggcgctcatgaacaagtttggcttccagtgg
ccggagcggctccgctgcgagaactttcccgtgcacggcgcgggcgagatctgcgtgggg
cagaacacatcggatgccccgccagggcccggtggcgcggggggccggggagccacggcg
cagccgacagccggctacctgcccgacctcctcaccccaccgcagcccgccgccggcttc
tccttctcttgccctcggcagctcaaggtgcccccctacttgggctaccgcttcctgggg
gagcgggactgtggagcgccctgtgagccgggccggcccaacgggctcatgtacttcaag
gaggcggaggtacgttttgcccggctctgggtgggtgtgtggtccgtgctctgctgtgca
tccaccctctttactgtgcttacctacctggtagacatgcgccgcttcagctacccagag
cgacccatcatcttcctctcgggctgctacttcatggtggcggtggcctacgcggcgggc
ttcctgctggaggagcgggtggtgtgcctggaacgcttctctgaggatggctaccgtacc
gtggcccaaggcaccaagaaagaaggctgcaccatcctcttcatgatcctctacttcttc
ggcatggccagctccatctggtgggtcatactgtccctcacctggttcctggcggctggc
atgaagtggggccacgaggccatcgaggccaactcccagtacttccacctggctgcctgg
gccgtgcctgctgtcaaaaccatcaccatcctagccatggggcaggtggacggcgatgtg
ctcagcggggtgtgctacgtgggcatctacagtgtggactcgctgcggggcttcgtgcta
gcgccgctcttcgtgtacctcttcatcggcacctccttcctgctggccggctttgtgtcc
ttgtttcgcatccgcaccatcatgaagcacgacggcaccaagacggagaagctggagaag
ctgatggtgcgcatcggggtcttcagcgtcctctacacagtccccgccaccattgtcctg
gcatgctacttctatgagcaggccttccgaagcacctgggagaagacgtggctcctccag
acgtgcaaaacctacgctgtgccctgccctagccactttgcccccatgagtccggacttc
acagtcttcatgatcaagtacctcatgaccatgatcgttggcatcacgacgggcttctgg
atctggtctggcaaaaccctacagtcctggcggcgcttctaccacagactgagcaccggc
agcaagggcgagacggcggtatga

DBGET integrated database retrieval system