KEGG   Gallus gallus (chicken): 374065
Entry
374065            CDS       T01006                                 

Gene name
KCNMA1
Definition
(RefSeq) calcium-activated potassium channel subunit alpha-1
  KO
K04936  potassium large conductance calcium-activated channel subfamily M alpha member 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    374065 (KCNMA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    374065 (KCNMA1)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   374065 (KCNMA1)
SSDB
Motif
Pfam: BK_channel_a Ion_trans Ion_trans_2 TrkA_N Lig_chan
Other DBs
NCBI-GeneID: 374065
NCBI-ProteinID: NP_989555
CGNC: 49029
Ensembl: ENSGALG00000004980
UniProt: Q8AYS8
Position
6
AA seq 1137 aa
MSNNINANNLNTDSSSSPVNVPKMDALIIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGL
FIILLWRTLKYLWTVCCHCGVKNKEAQKINGGGDTRADGACKPTDEKEENVAAEVGWMTS
VKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSNPIESCQNFYKDFTLQIDMAF
NVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQ
FSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNNQQLTYWE
CVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSY
SAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNIEIVFLHNISPNLELEALFKRHFT
QVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRI
ITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSSLAPGLSTMLANLFSMRSF
IKIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELVFAKLKLLMIAIEYKSEKRE
SSILINPGNHVKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDE
QPSTLSPKKKQRNGGMRNSPNSSPKLMRHDPLLIPGNEQIDNMDANVKKYDSTGMFHWCP
AKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSALIGLRNLVMPLRASNFHYHELKHIVF
VGSLEYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDASLQ
DKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLLRQPSITTGANI
PIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTL
IRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCY
GDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFD
HNAGQSRASLSHSSHSSYSSSKKSSSVHSIPSTANRPNRTKTRDSREKQKYVQEDRL
NT seq 3414 nt   +upstreamnt  +downstreamnt
atgagtaacaatatcaacgccaacaatctcaacacagactcgtcctcctcccccgtcaat
gtgcccaagatggatgcgctcatcatcccggtgaccatggaggtgccctgcgatagccgc
ggacagcgcatgtggtgggctttcctcgcctcatctatggtcactttctttgggggactg
tttatcattctgctgtggaggaccctcaagtacctgtggactgtctgctgccactgcggg
gtcaaaaacaaggaggcccagaagattaatggtggtggagataccagggcagatggggcc
tgcaaaccaacagatgaaaaagaggagaacgtggcagcagaagtgggatggatgacctcc
gtgaaagactgggcaggagtcatgatatctgcccagacactaactggcagagtacttgtt
gtcttagtcttcgctcttagtattggtgctcttgtaatatacttcatagattcatcaaac
ccaatagaatcctgccagaatttctacaaagatttcacattacagattgacatggctttc
aatgtgttcttcctactctacttcggcttgcgtttcatagcagccaatgacaagctatgg
ttttggcttgaagtcaactcagtagtagatttcttcacggtccctccagtgtttgtttca
gtatatttaaacagaagttggcttggtttaagatttttaagagcccttagactgatacag
ttttcagaaatattgcagtttctgaatatccttaaaacaagtaattccatcaagctagtg
aatctgtgctctatatttatcagcacatggctgacagcagctgggttcatacatttggtg
gagaactcaggggatccttgggaaaatttccaaaataatcaacagttaacatattgggaa
tgtgtttatttactgatggttacaatgtccactgttggttatggagatgtttatgcaaaa
acaacccttggtcgccttttcatggtcttcttcatccttgggggattggccatgtttgcc
agctacgtccctgaaatcatagagttaataggaaaccgcaagaaatatggtggttcctat
agtgcggttagtggaagaaagcacatagttgtctgtggtcacataacacttgaaagcgtg
tccaacttcctgaaggacttcctgcacaaggatagggatgatgttaacatagaaatcgtc
tttctgcataatatctcccctaaccttgagctggaagctctttttaaacgacacttcact
caggtggaattttatcagggttcagtccttaatccccatgacctggcaagagtaaagata
gagtcagcagatgcgtgcctaattcttgccaataaatactgcgctgacccagatgctgag
gatgcctccaatattatgagagttatttcaataaagaattatcatccgaagataagaatt
atcactcagatgttgcagtatcacaataaggctcatctgttaaatattccaagctggaat
tggaaggaaggggatgatgcgatctgtcttgctgagctcaagctgggtttcatagctcag
agttcgctggcaccaggcctttcaacaatgttagccaacctcttttccatgagatcattc
ataaagattgaggaggatacatggcagaaatactatctggaaggagttgcaaatgaaatg
tatacagaatatctgtctagtgcctttgtgggtttgtccttccctgcagtttgtgaactg
gtgtttgcgaaactaaagctcttaatgatagccatagaatacaagtcggaaaaaagagaa
agcagtatattgatcaatcctggaaaccatgtgaagattcaagaaggtaccttaggattc
ttcattgcaagtgatgccaaagaagtaaaaagggcatttttttactgcaaggcctgccat
gatgacatcacagatcccaaaaggataaaaaagtgtggctgcaaacggcttgaagatgag
cagccgtcaacactatcacccaaaaaaaagcaacgaaatggaggcatgcgaaattcaccc
aactcctcacccaaactgatgaggcatgaccccttgttaattcctggcaatgaacagatt
gacaatatggatgccaatgtgaaaaaatatgactctacgggaatgtttcattggtgtcca
gccaaggatattgaaaaggtcattttgactcgaagtgaagcagcgatgacagttttaagt
gggcatgtagtcgtttgcatatttggggatgttaaatctgctttgattggattaagaaat
ttagtgatgccattacgagccagcaactttcactaccatgaactcaagcacattgtgttt
gtgggttcacttgaatacctgagaagggagtgggagaccctgcataacttccccaaggtt
tcaatcttgcctggtacaccattaagtcgggctgatttaagggctgtcaacatcaacctc
tgcgacatgtgcgttatcctgtcagccaatcagaataatattgatgatgcttcgctgcag
gacaaggaatgcatcttggcgtcactcaacatcaaatctatgcagtttgatgacagcatt
ggggtcttgcaggctaattcccaaggctttacaccccctggtatggataggtcatctcca
gacaacagtcctgtccacggcctgttacgtcaaccctccattacaacaggagccaacatc
cctattataacagagctagtaaatgattcaaatgttcagttcttggaccaagatgatgat
gatgatccagatacagaactgtacctcacgcagccctttgcatgtggaaccgcatttgct
gtcagcgtgctggactctctcatgagcgcaacatacttcaatgacaatatcctcacactg
atacggacattggtaacaggaggagccacaccagagctggaagcactgattgccgaggaa
aatgctttgagaggaggttacagcacgccccagacacttgcaaacagggacaggtgtcga
gttgctcagttggctttgtatgatgggccatttgcagacctaggggatggaggctgctat
ggagatctattttgtaaagcactgaaaacatacaatatgctttgctttggaatttatcga
ttaagggacgctcatctaagtactcccagccaatgcactaaacgttatgttatcacaaac
ccaccatatgagtttgagcttgtgccgacagacttgatcttctgtttgatgcaattcgac
cacaatgctggccagtcccgggccagtctttctcattcctcccattcctcctattcttcc
agcaagaagagctcatcagttcactccatcccatcaacagcaaaccgaccgaaccgcacc
aagaccagggattcccgggaaaaacagaagtatgtgcaggaagatagactttga

DBGET integrated database retrieval system