KEGG   Gallus gallus (chicken): 374068
Entry
374068            CDS       T01006                                 

Gene name
CDH5
Definition
(RefSeq) cadherin-5 precursor
  KO
K06533  cadherin 5, type 2, VE-cadherin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    374068 (CDH5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    374068 (CDH5)
   04090 CD molecules [BR:gga04090]
    374068 (CDH5)
Cell adhesion molecules [BR:gga04515]
 Cadherins
  Major cadherins
   374068 (CDH5)
CD molecules [BR:gga04090]
 Proteins
  374068 (CDH5)
SSDB
Motif
Pfam: Cadherin Cadherin_C TMEM192 Cadherin_4 Orf78 DUF443
Other DBs
NCBI-GeneID: 374068
NCBI-ProteinID: NP_989558
CGNC: 3922
Ensembl: ENSGALG00000032349
UniProt: Q8AYD0
Structure
PDB: 
3PPE

Position
11
AA seq 773 aa
MKKLILLFSLFLAPAFSYKENQKINQNFSSNNTSHKRLKRDWIWNRMHIREEIDSPLPHH
VGKLTSSVGNKNAMYIIEGESANTIFKVQGYDGDIYAFERLDREKKAEYELTAHIIDRRN
NRSLEPPSKFIIKVSDINDNAPIFVQKIFNGSVPEMSRLGTSVTKVTAEDADDPTVAGHA
TVTYQIIKGNEYFTVDDSGVIFTARADLDRESQSAYEIIVKAKDALGLTGESSTATVIIR
LTDINDNFPVFKHPSFHFRVPENISVGGEVGRVKVEDIDEPQHRNTKYSFVRGDYRDTFE
IIANPFTNEGIIRPKKPLDFEKVAEYRFDIEATDHNVNPAYYKPGGSRSISTITIEVTDV
DEPPVFTKLSYEFKVRENDPEIKTLGSVWAHDPDAAKRKIRFARRRASPNGDYVRVSDSG
IIQLPKPLDREFSSLYNITVAAQEILEDGRLSDRESHAQVHVIVTDENDNAPELVYPEEP
RVCENAAPGKVIIRISATDKDEISPGGFFTYSLTTEDSNFSLTENPDNTANITVKDGQFN
RELAKIHYLPVIISDNGNPELSSTNTLVISVCKCNEKGDFTFCEERAKQVGVSVQALVAI
FICIFTIIAVIALLILLRKRHKKDLSGLRRNVAEIHEQLVTYDEEGGGEMDTTSYDVSVL
NSVRKNGIKPEVVPSAYAQVQKPPGNTTSGAGEMEMMIEVKKDEADNDRDLLPYDTLHIY
GYEGAESIAESLSSLESGSSDSDIDYDFLNDWGPRFKMLAELYGSEPNEDFVY
NT seq 2322 nt   +upstreamnt  +downstreamnt
atgaagaagcttattctgcttttctcattgttcttggctccagcattctcttataaagaa
aatcagaaaataaaccaaaacttttcttcaaacaataccagtcataaacgacttaagaga
gactggatatggaaccgaatgcatatcagagaagagattgattcaccattaccacatcac
gttggcaagctcacatcgagtgtagggaacaagaatgctatgtatattattgaaggtgaa
tctgccaacaccatctttaaagtgcaagggtacgatggcgacatatacgcttttgagagg
ctggacagagaaaagaaagcagagtatgagctgacagcacacatcattgacagaagaaac
aaccgatcgctggaaccaccatctaaatttattatcaaggtttctgatattaatgacaat
gctcccatttttgtacaaaagatattcaatggatctgtcccagaaatgtcacgattagga
acctcagttaccaaagtgacagctgaagatgccgatgacccaacagttgcaggtcatgcc
acagttacctaccaaatcattaaaggaaatgaatatttcacagttgatgactccggtgtg
attttcacagcaagagctgatttggacagagagagtcaatcagcatatgaaattattgtt
aaagcaaaagatgctctagggcttaccggggagtcaagcacagctacagtcattatcagg
ttaacagacatcaatgacaacttcccagtattcaaacacccatcatttcacttcagagtt
cctgaaaacatttcagtaggaggagaagttggccgagttaaagttgaagatattgatgaa
ccacaacacagaaatacaaaatacagttttgtcagaggagactacagggacacctttgaa
attatagcaaatccattcaccaatgaaggaatcattagaccaaagaagcccctggacttc
gagaaagtagcagagtacaggtttgacattgaagcaacagatcacaacgttaaccctgcc
tactacaaacctggtggctccaggagcatttcaacaattaccattgaagttacagatgta
gatgagcctcctgtcttcaccaaactatcatatgaattcaaagtacgggagaatgatcct
gaaataaaaacacttggctccgtttgggcacatgaccccgacgcagctaaacggaaaatc
agatttgctcgacgaagagctagccctaatggagactatgttagagtatctgattctgga
attattcagcttcctaagcccctagatagagaattcagctccttatacaacatcactgtg
gcagcccaggaaatcctggaggatggccgtctttctgacagagaatcacacgcacaagtt
cacgtcattgtcactgacgaaaatgataatgctccagaactcgtttatcctgaggaaccc
agagtgtgcgaaaatgctgcgccggggaaggtaatcatcaggatttcagctactgacaag
gatgaaatatcacctggaggtttcttcacatactccctaaccacagaagatagcaacttc
tccttgactgagaaccccgataacacagctaatatcactgtcaaggatggacagtttaat
cgtgaacttgccaaaatccactacctgcctgtcatcatctcagacaacggcaatcctgag
ctcagcagcacaaacacacttgttatcagtgtctgcaagtgtaatgaaaaaggcgacttc
actttttgtgaggaaagagctaaacaagttggagttagtgtacaagcactggtggcaatt
ttcatctgtatcttcacaatcattgcagtgattgcattgctaattcttctaaggaagaga
cacaagaaggatctgagcggtctcaggaggaatgtggcagagatccacgagcagcttgtc
acttacgatgaagaaggtggcggtgaaatggacaccaccagctatgatgtgtccgtgctc
aactccgtgcgcaagaatggtataaagccagaagtggtgccttctgcatatgcacaggtc
caaaagcctcctggaaatacaacttctggtgctggagaaatggaaatgatgatcgaggtt
aaaaaggacgaagctgacaatgacagggatctgctgccatatgacacgcttcacatttat
ggctacgaaggggccgagtccattgcagaatctctcagttctttggaatcaggctcctca
gactcagatatcgattatgacttcctaaatgactggggacccaggtttaaaatgttagct
gagctgtatggatcagaaccaaatgaagattttgtgtattaa

DBGET integrated database retrieval system