KEGG   Gallus gallus (chicken): 374069Help
Entry
374069            CDS       T01006                                 

Gene name
MYH1B
Definition
(RefSeq) myosin, heavy chain 1B, skeletal muscle
  KO
K10352  myosin heavy chain
Organism
gga  Gallus gallus (chicken)
Pathway
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    374069 (MYH1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    374069 (MYH1B)
   04147 Exosome [BR:gga04147]
    374069 (MYH1B)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     374069 (MYH1B)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   374069 (MYH1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_head Myosin_tail_1 Myosin_N BBP1_C DUF1664 IQ AAA_22 AAA_16
Motif
Other DBs
NCBI-GeneID: 374069
NCBI-ProteinID: NP_989559
CGNC: 49031
Ensembl: ENSGALG00000039977
UniProt: A0A1D5NVW6
Position
18
AA seq 1944 aa AA seqDB search
MASPDAEMAAFGEAAPYLRKSEKERIEAQNKPFDAKSSVFVVHPKESFVKGTIQSKETGK
VTVKTEGGETLTVKEDQIFSMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYS
GLFCVTVNPYKWLPVYNPEVVLAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITG
ESGAGKTVNTKRVIQYFATIAASGEKKKEEQPGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLKAERSYHIFYQIMSNKKPEL
IDMLLITTNPYDYHFVSQGEITVPSINDQEELMATDSAIDILGFTADEKVAIYKLTGAVM
HYGNLKFKQKQREEQAEPDGTEVADKAAYLMGLNSADLLKALCYPRVKVGNEYVTKGQTV
QQVNNSVGALAKAVYEKMFLWMVVRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEE
CMFPKATDTSFKNKLYDQHLGKSSNFQKPKPAKGKAEAHFSLVHYAGTVDYNITGWLEKN
KDPLNETVIGLYQKSSVKTLALLFANYGGAEAEASGGGGGGKKGGKKKGSSFQTVSALFR
ENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSR
VLYADFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIDVDHTQYKFGHTKVFFKAGLLGL
LEEMRDEKLAQLITRTQARCRGFLMRVEYQRMVERRESIFCIQYNVRAFMNVKHWPWMKL
FFKIKPLLKSAESEKEMANMKEEFEKTKEELAKSEAKRKELEEKMVKLVQEKNDLQLQVQ
AEADALADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKK
DIDDLELTLAKVEKEKHATENKVKNLTEEMAALDETIAKLTKEKKALQEAHQQTLDDLQA
EEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKMSQDTIMDLEND
KQQLDEKLKKKDFEISQIQSKIEDEQALGMQLQKKIKELQARIEELEEEIEAERTSRAKA
EKHRADLSRELEEISERLEEAGGATAAQIDMNKKREAEFQKMRRDLEEATLQHEATAAAL
RKKHADSTAELGEQIDNLQRVKQKLEKEKSELKMEIDDLASNMESVSKAKANLEKMCRTL
EDQLSEIKSKEEEHQRMINDLSTQRARLQTESGEYSRQVEEKDALISQLSRGKQAFTQQI
EELKRHLEEEIKAKNALAHALQSARHDCDLLREQYEEEQEAKGELQRALSKANSEVAQWR
TKYETDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDV
ERANAACAALDKKQKNFDKILAEWKQKYEETQAELEASQKESRSLSTELFKMKNAYEESL
DHLETLKRENKNLQQEISDLTEQIAEGGKAIHELEKVKKQIEQEKSEIQAALEEAEASLE
HEEGKILRLQLELNQVKSEIDRKIAEKDEEIDQLKRNHLRIVESMQSTLDAEIRSRNEAL
RLKKKMEGDLNEMEIQLNHANRVAAEAQKNLRNTQGVLKDTQIHLDDALRTQEDLKEQVA
MVERRANLLQAEIEELRAALEQTERSRKVAEQELMDASERVQLLHTQNTSLINTKKKLET
DIAQIQSEMEDTIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLDQTVKD
LQLRLDEAEQLALKGGKKQIQKLEARVRELEGEVDAEQKRSAEAVKGVRKYERRVKELTY
QSEEDRKNILRLQDLVDKLQMKVKSYKRQAEEAEELSNVNLTKFRKIQHELEEAEERADI
AESQVNKLRAKSREFHGKKIEEEE
NT seq 5835 nt NT seq  +upstreamnt  +downstreamnt
atggcttctccagatgctgaaatggccgcctttggggaggctgctccttatcttcgaaag
tcagagaaggaacgaatcgaggcccagaacaagccttttgatgccaagtcatcagtcttt
gtggtgcatcccaaagaatcttttgtgaaagggactatccagagcaaagaaacagggaag
gtcactgtcaagactgaaggtggagaaactctaactgtgaaggaagatcaaatcttctcc
atgaatcctcccaagtacgataaaattgaggacatggccatgatgacccacctccacgaa
cccgctgtgctgtacaacctcaaagagcgttatgcagcctggatgatctacacctactcg
ggcctcttctgtgtcactgtcaacccctacaagtggctgccggtgtacaacccggaggtg
gtgttggcctaccgaggcaaaaagcgccaggaggcccctccacacattttctccatttct
gacaacgcctatcagttcatgctgactgaccgtgagaatcagtcgatcctgatcaccgga
gaatctggtgcagggaagactgtgaacacgaaacgtgtcatccagtactttgcaacaatt
gcagctagtggggagaagaagaaggaggagcagcctggcaaaatgcagggaacgcttgag
gatcaaatcatcagcgccaacccattgctagaggcctttggaaatgccaagactgtgagg
aatgacaactcctcacgctttgggaaattcatcagaattcactttggtgccacaggaaaa
ctagcttctgcagatattgaaacatatctattggagaagtctagagtcacttttcagctg
aaggcagaaagaagctaccacatattttatcaaattatgtccaacaagaaaccagagcta
attgacatgcttctaattaccaccaatccatacgactatcactttgtgagtcaaggtgag
atcactgttcccagcattaatgatcaagaggagctgatggctacagatagtgccattgac
atcctgggctttactgccgatgaaaaagtggctatttacaagctgacaggagctgtcatg
cactatggcaacctgaagttcaagcagaaacaaagagaagagcaagcagagccagatggc
acagaagttgcagacaaggctgcctacctgatgggtctgaactcagcagacctgctcaag
gccctgtgctatcctcgtgtcaaggttgggaatgagtacgtgaccaagggtcaaactgtg
cagcaggtgaacaactcagttggtgctctggcaaaggctgtctatgagaagatgttcttg
tggatggttgttcgcatcaaccaacagttggataccaagcagcccaggcagtacttcatt
ggtgtcctggacatcgctggatttgagatctttgatttcaacagcttggagcagctgtgc
atcaacttcaccaatgagaaactgcaacagttcttcaaccaccacatgttcgtgctggaa
caggaggagtacaagaaggaaggcattgaatgggagttcattgactttgggatggacctg
gctgcttgcattgagctcattgaaaagcccatgggcatcttctccatcctggaagaggag
tgcatgttccccaaggcaactgacacctctttcaaaaacaagctctatgaccagcatctg
ggcaagtccagcaacttccagaagcccaagcctgccaaaggcaaggctgaggcccacttc
tctctggtgcactatgctggcacagtagactacaacatcactggctggctggagaagaac
aaggaccccctgaacgaaactgtcattgggctataccagaaatcatctgtgaagacactg
gccttactgtttgccaactatggtggagcagaagcagaggctagtggtggtggtggtggt
ggcaagaaaggtggcaagaagaagggttcttctttccagactgtctcagcccttttccgg
gagaacctaaacaaactgatgaccaacctacggagtactcaccctcattttgttcgctgc
atcatcccaaatgaaacaaaaacacctggtgccatggagcatgaactggtgctgcaccag
ctgcgctgtaacggcgtgctggaggggatcaggatttgcaggaaaggcttccctagcaga
gtcctctatgcagactttaaacagaggtacaaggtgcttaatgccagtgccatccctgag
ggacagttcattgatagcaagaaagcttctgagaagcttcttgggtcaattgatgtggac
cacacccagtacaaatttggtcacaccaaggtgttcttcaaagctgggctgctgggactc
ctggaggagatgagagatgagaagctggcacagctcatcactcgcacacaggccaggtgc
aggggcttcctgatgagagtggagtaccagagaatggtggagaggagggaatccatcttc
tgcattcagtacaatgttcgtgcattcatgaatgtcaagcactggccctggatgaagctg
ttcttcaagatcaagcccctgctgaagagcgcagagtctgagaaggagatggccaacatg
aaggaagaatttgagaagaccaaggaggagcttgcaaagtctgaggcaaagaggaaggag
ctggaggagaaaatggtgaagctggtgcaggagaaaaatgatctgcagctccaagtgcag
gctgaagctgatgctttggctgatgctgaggaaaggtgtgaccagctcatcaaaaccaaa
atccagctggaagccaaaattaaggaggtgacagaacgggctgaggatgaggaggaaatt
aatgctgaactgacagccaagaagaggaaactggaggatgaatgctcagagctgaagaaa
gatatagatgacctggagttaacattggccaaagttgagaaggaaaagcatgccactgaa
aacaaggtgaaaaacctcacagaagagatggcagccctggatgagacaattgccaagctg
acaaaagagaagaaagccctccaagaggcccatcagcagacactggatgacctgcaggct
gaagaggacaaagtcaatacgctgaccaaagctaaaaccaagctggaacagcaagtggac
gatctggaagggtccctggagcaagagaagaagctgcgcatggacctcgagagagctaag
aggaaacttgaaggagacctgaagatgtcccaggataccataatggatttggaaaatgat
aaacagcagctggatgagaaactgaagaagaaagactttgaaatcagccagatccagagc
aaaattgaggatgagcaagccctgggcatgcagttacagaagaagatcaaggagctgcag
gcccgtattgaggaactggaggaggaaatcgaggcagagcgaacctctcgggcaaaagca
gagaagcaccgagctgacctctccagggagctggaggagatcagtgagcgcctggaggaa
gcaggaggggctacagcagctcagattgatatgaacaagaagcgtgaggcagaatttcag
aagatgcgccgtgacctcgaagaggccacgctgcagcacgaagccacggctgctgccctg
cggaagaagcatgcggacagcacagcggagcttggggagcagatcgacaacctgcaacgt
gtcaagcagaagctggagaaggagaagagtgagctgaagatggagattgatgacttggcc
agcaacatggagtctgtctccaaagctaaggcaaacctggaaaagatgtgtcgtacttta
gaagaccaactgagtgagattaagtcaaaggaggaggagcatcaacgcatgataaacgat
ctcagcactcaaagagctcgtctgcagacagaatcaggtgaatattcacgccaggtggag
gagaaagatgccctgatatctcagctgtctcgaggcaagcaggcattcacccaacagatt
gaggaactcaagcggcacttagaggaagaaatcaaggccaagaacgccctggcccacgcc
ttgcagtctgctcgtcatgactgtgatttgctccgggaacaatatgaagaggagcaggaa
gccaagggtgagctgcagcgtgccctgtccaaggccaacagtgaagtggcccagtggaga
accaaatatgagacagatgctattcagcgcacagaggaactggaggaggccaagaagaag
ctggcacagcgcctgcaggatgccgaggaacatgttgaagctgtgaatgccaaatgtgct
tccctggaaaagacaaagcagaggctgcagaatgaggtggaggacctgatgattgacgtg
gagcgagcaaatgctgcctgcgcagctctggacaagaagcagaagaactttgacaagatc
ctggcagagtggaagcagaagtacgaggaaacgcaggctgagctggaggcctcccagaag
gagtctcgctccctcagcacagagctgtttaagatgaagaatgcctatgaggaatccctg
gaccacctggaaacgctgaagcgtgagaacaagaacttgcagcaggagatttctgacctc
acggagcagattgcagagggaggaaaggcaattcatgagttggagaaagtcaagaagcag
attgagcaggagaagtctgaaatccaggctgctctggaagaagctgaggcctccctggaa
catgaagaggggaagatcctgcgcctccaactggagctcaaccaggtcaagtctgagatt
gacaggaaaatagcagagaaagatgaggaaattgaccagctgaagagaaatcacctcaga
attgtggagtccatgcagagcactctggatgctgagatcaggagcaggaatgaagccctt
agactgaagaagaagatggagggagacctgaatgaaatggagatccagctcaaccatgcc
aaccgcgtggctgcagaggcacaaaagaaccttagaaacacacaaggagtgctcaaagat
acccagatacacttggatgatgctctcaggacacaggaggacctgaaggagcaggtggcc
atggtggagcgcagagcaaacctgttgcaggctgagattgaggagctacgggcagccctg
gaacagacagagcgctcgagaaaagtggctgagcaggaattgatggatgcaagtgagaga
gttcagctcctccacactcagaacaccagcttgatcaacaccaagaagaaactggaaaca
gacattgcccaaattcagagtgaaatggaggataccatccaggaagcccgcaatgctgaa
gagaaggccaagaaggccatcaccgatgcagccatgatggcagaagagctgaagaaggag
caggacaccagtgcccacctggagaggatgaagaagaacctggaccagacggtgaaggat
ctgcagctccgtctggatgaggcagagcagctggccctgaagggaggcaagaagcaaatt
cagaagctggaggccagggtgcgggagctggaaggggaggttgatgctgagcagaagcgc
agcgctgaagccgtgaagggtgtgcgcaagtacgagaggagggtgaaggagctgacatac
cagtctgaggaagatcgcaagaacattcttagactccaggatctggtggacaaactgcag
atgaaggtgaaatcctacaagagacaagctgaggaggctgaggagctgtccaatgtcaac
ctcaccaagttccgcaagatccagcatgagctggaggaagccgaggagcgggctgacatt
gcagagtcacaggtcaacaagctccgagcaaagagccgggagtttcatggcaagaagata
gaagaggaagagtga

DBGET integrated database retrieval system