KEGG   Gallus gallus (chicken): 374080
Entry
374080            CDS       T01006                                 

Gene name
TLE4Z1
Definition
(RefSeq) transducin-like enhancer protein 4
  KO
K04497  groucho
Organism
gga  Gallus gallus (chicken)
Pathway
gga04310  Wnt signaling pathway
gga04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    374080 (TLE4Z1)
   04330 Notch signaling pathway
    374080 (TLE4Z1)
SSDB
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 HALZ
Other DBs
NCBI-GeneID: 374080
NCBI-ProteinID: NP_989568
CGNC: 49035
Ensembl: ENSGALG00000015184
UniProt: Q8JIM6
Position
Z
AA seq 773 aa
MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEK
TEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQV
TMAELNAIIGQQLQAQHLSHGHGLPVPLTPHPSGLQPPAIPPIGSSAGLLALSSALGGQS
HLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRTAEKHRNSTDYSSESKKQKTEEKEIA
ARYDSDGEKSDDNLVVDVSNEDPSSPRGSPAHSPRENGFDKTRLLKKDAPISPASIASSS
STPSSKSKELSLNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKPPGVDPLASGL
RTPMAVPCPYPTPFGIVPHAGMNGELTSPGAAYAGLHNISPQMSAAAAAAAAAAAYGRSP
VVGFDPHHHMRVPGIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQ
INTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCR
LLPDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGN
IAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFT
SQIFSLGYCPTGEWLAVGMENSNVEVLHVTKPDKYQLHLHESCVLSLKFAHCGKWFVSTG
KDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
NT seq 2322 nt   +upstreamnt  +downstreamnt
atgatccgcgacctgagcaagatgtacccgcagacccggcacccggctccgcaccagcca
gcgcagccctttaaattcaccatctccgagtcctgcgatcggattaaggaggagttccag
ttcctgcaggcgcagtaccacagtttaaagctagaatgtgagaagctggccagcgagaag
acagagatgcagcggcattatgtcatgtattatgagatgtcctatgggctgaatatagaa
atgcataagcaggcagaaattgtcaagagactgaatgctatatgtgcacaagtcattccc
ttcctgtcccaagagcaccagcaacaagtggtgcaggctgtggagcgtgccaagcaagtg
accatggcagaactgaacgcaatcattgggcaacaactccaggcccagcatttgtcacat
ggacatggtctccctgtacctctcactccgcacccctcgggcttgcagcctccagccatc
ccacccattggcagcagtgctggccttctggcactgtccagtgcgctgggggggcagtca
cacctcccgatcaaggatgaaaaaaagcaccatgataacgatcaccaaagagacagagac
tccatcaagagctcttctgtatctccctcagccagtttcagaacagcagaaaagcacaga
aattcgacagattattcttcagagagtaaaaaacagaaaacagaagagaaggagatagca
gctcgttatgacagtgatggtgaaaagagtgatgacaacttggtagttgatgtttccaat
gaggatccttcctctccacgggggagcccagcacactctccaagagagaatggctttgac
aagactcgactgctgaagaaagatgcaccaattagtccagcgtctattgcatcctccagc
agtactccttcctccaaatccaaagaacttagccttaatgagaaatctactactcctgta
tctaaatcaaataccccaactccacggactgatgcaccaactccaggcagcaactccact
cctggactgaggcctgtgcctggcaaacctccgggtgtggacccactagcttcaggttta
aggacacctatggcagtgccatgtccctatccaactccatttggcattgtgccgcatgct
ggtatgaatggagagctgaccagccctggagctgcatatgctggtctgcacaacatttcc
cctcagatgagtgcagcggctgcagcagctgcagcagctgcagcttatgggagatctcca
gtggttggttttgatccacatcatcacatgcgagtcccaggcatcccccccaatctcaca
ggcatcccaggaggaaaaccggcatattcatttcatgtaagtgcagatggccagatgcag
cctgttcctttccctcccgatgccctcatcggtccaggaatccctcgccatgcccgtcag
atcaacactctgaaccatggggaagttgtgtgcgcagttaccatcagcaaccccacgaga
catgtgtacacgggtggcaaggggtgtgtcaaagtctgggatatcagccaccctggcaac
aagagccctgtctctcagctcgactgcctgaacagagataactacatccgttcctgcaga
ttgctccctgacggccgcaccctgattgttggtggagaagccagcacgttatccatttgg
gacctggcagctccgactccacgcattaaagcagagctgacatcttctgctccagcttgc
tatgccctagcaatcagccctgattccaaggtctgcttctcttgctgtagtgatgggaat
attgcagtgtgggatctgcataaccagactttggtaagacaatttcagggtcacacagat
ggagccagctgcattgacatttctaatgatggcaccaagctttggacaggaggcttggac
aatacggtcagatcctgggacctcagagaagggagacagctacagcaacatgacttcacg
tcacagatcttctcactgggctattgtccaactggtgaatggttggcagtaggaatggag
aacagtaacgttgaggtgctgcatgttactaaaccggacaagtatcagctacatcttcat
gagagctgtgtgttgtcactcaaatttgctcactgtggcaaatggtttgtaagcactgga
aaagataatcttcttaatgcctggagaacaccttatggagccagtatattccagtccaaa
gaatcctcatccgtgcttagctgtgatatctctgtggatgacaagtacattgtcactggc
tctggggacaagaaagctacagtctatgaagttatttattag

DBGET integrated database retrieval system