KEGG   Gallus gallus (chicken): 374096
Entry
374096            CDS       T01006                                 

Gene name
SMAD6
Definition
(RefSeq) mothers against decapentaplegic homolog 6
  KO
K04677  mothers against decapentaplegic homolog 6
Organism
gga  Gallus gallus (chicken)
Pathway
gga04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    374096 (SMAD6)
SSDB
Motif
Pfam: MH2 MH1
Other DBs
NCBI-GeneID: 374096
NCBI-ProteinID: NP_989579
CGNC: 66183
UniProt: C3U1W5
Position
10
AA seq 431 aa
MFRSKRSGLVRRLWRSRVIPERDGGDGNGQSSERNATAVTAEGQRMAQPRRAHEGEGRPV
RCCLFAERPGPELPPPPPPPPPGGASPPGPGGGEARSRLVLLERELKAVTYALLKRLKER
SLHSLLQAVESRGGTPGGCVLVARGELRLGGGQAAPPHLLLGKLFRWPDLQHPAELKALC
ECQSFGAADGPTVCCNPYHFSRLCGPESPPPPYSRLSPNDEQKPLDLSDPTLSYTETEAT
NSPNVTPGEFSDASTSPDAVKRSHWCNVAYWEHRTRVGRLYTVYEQSVSIFYDLPQGNGF
CLGQLNLENRSETVRRTRSKIGYGILLSKEPDGVWAYNRSEHPIFVNSPTLDIPNCRTLI
VRKVMPGYSIKVFDYEKSCLLQHTAELDYADGPYDPNSVRISFAKGWGPCYSRQFITSCP
CWLEILLSNNR
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgttcaggtccaaacgctcagggctggtgcggcggctttggaggagccgcgttatcccg
gagagggacggaggagatgggaacggccaaagctcggagcgaaacgcgacggcggtgacg
gccgagggacagcgcatggcacagccgcgccgggcgcatgagggcgagggccgcccggtg
cgctgctgcctgttcgccgagcggcccggccccgagctgccgccgccgccgcctcctcct
cctcccggcggcgcctctccccccgggccgggcggaggcgaagcgcggtcgcggttggtg
ctgctggagcgggagctgaaggccgtcacctacgcgctgctgaagcggctgaaggagcgc
tccctgcacagcctcctgcaggcggtggagtcgcgcggcggcactccgggcggctgcgtg
ttggtggcccgcggggagctgcgcctggggggcggccaggcggcccccccacacctgctg
ctggggaagctgttccgctggcccgacctgcagcaccccgccgagctgaaggccctgtgc
gaatgtcagagcttcggggcggccgacggccccaccgtgtgctgcaatccgtaccacttc
agccggctctgtgggccagagtctccgccgcctccctactcccggctgtctcctaacgac
gagcaaaagccactggatctctcggatcccacgttgtcttacactgaaacggaggcgacg
aactcacccaacgtcacgcccggggagttctcagacgccagcacgtcgcccgatgccgtg
aagaggagccattggtgcaacgtggcctactgggagcaccggacgcgcgtcggccgcctc
tacacagtgtacgaacagtctgtcagtatattttatgacctacctcaaggaaacggcttc
tgcctcggacagctaaacctggaaaacaggagcgagactgtgagaaggactcgaagtaaa
atcggttacgggattttacttagcaaagaaccggacggtgtgtgggcttacaatcgcagc
gagcatcccatcttcgtcaactccccgacactggacatccccaactgtaggactttgata
gtgcgcaaggtgatgccgggctattccatcaaggtgtttgactacgagaagtcctgcctc
ttgcagcacactgcggagctggattatgcagacgggccctacgaccccaacagcgtgcgg
atcagctttgccaagggctgggggccgtgttactcgagacagttcatcacgtcttgcccg
tgttggctggagatcttgctcagtaacaatcgataa

DBGET integrated database retrieval system