KEGG   Gallus gallus (chicken): 374101
Entry
374101            CDS       T01006                                 

Gene name
SCX
Definition
(RefSeq) basic helix-loop-helix transcription factor scleraxis
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 374101
NCBI-ProteinID: NP_989584
CGNC: 49042
Ensembl: ENSGALG00000043433
UniProt: P59101
Position
2
AA seq 187 aa
MSFAMLRPAAGRYLYPEISMLSEDEENGSESSGSDEKPFHLDADGFGIKAGKRRSGKKAG
RLHREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLG
NVLLVGEACGDGQPCHTSPAFFHHGGGGGSPPPRDSENSQPKQICTFCLSNQRKLSKDRD
RKTAIRS
NT seq 564 nt   +upstreamnt  +downstreamnt
atgtccttcgccatgctgcgccccgcggccggccgttacctgtaccccgagatcagcatg
ctgtcggaggacgaggagaacggcagcgagagctcgggctccgacgagaagcccttccac
ctggacgccgacggcttcggcatcaaagccggcaagaggaggagcggcaagaaagccggg
cggctgcaccgcgagccccggcagcggcacacggccaacgcgcgagagcgcgaccgcacc
aacagcgtcaacaccgccttcacggcgctgcgcaccctcatccccaccgagccggccgat
aggaagctgtccaagatcgagacgctgcgcctggcctccagctacatctcccacctgggc
aacgtgctgctggtgggagaggcgtgcggcgacgggcagccgtgccacaccagcccggct
ttcttccaccacggcggaggaggcggcagccccccgccacgcgactccgagaactcccag
cccaaacagatctgcactttctgcctcagcaaccagaggaagctgagtaaagaccgcgac
aggaagacggcgatccggagctag

DBGET integrated database retrieval system