KEGG   Gallus gallus (chicken): 374113Help
Entry
374113            CDS       T01006                                 

Gene name
ADAM10
Definition
(RefSeq) disintegrin and metalloproteinase domain-containing protein 10 precursor
  KO
K06704  disintegrin and metalloproteinase domain-containing protein 10 [EC:3.4.24.81]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    374113 (ADAM10)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    374113 (ADAM10)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.81  ADAM10 endopeptidase
     374113 (ADAM10)
Peptidases and inhibitors [BR:gga01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   374113 (ADAM10)
CD molecules [BR:gga04090]
 Proteins
  374113 (ADAM10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin_2 Reprolysin_5 Reprolysin_3 Reprolysin_4 Disintegrin Pep_M12B_propep Reprolysin Peptidase_M66
Motif
Other DBs
NCBI-GeneID: 374113
NCBI-ProteinID: NP_989592
CGNC: 3093
Ensembl: ENSGALG00000004212
UniProt: Q5F3N4 Q5F458 Q8QFX0
Position
10
AA seq 749 aa AA seqDB search
MDLARTIILLCSWAAGAGGQYGNPLNKYIRHYEGLSYDVDLLHQKHQRAKRAVSHEDQFL
RLDFHAHGRQFNLRMKRDTSLFSEDFKLETSNQVIDYDTSHIYTGHIYGEQGSFSHGSVI
DGRFEGFIQTHSGTFYVEPAERYIKDRTLPFHSVIYHEDDIKYPHKYGPQGGCADHSVFE
RMQKYQMTGIEEPTTEKPSEESDSDGPQLLRKKRATQAEKNTCQLYIQTDHLFYKHYGTR
EAVIAQISSHVKAIDTIYRSTDFSGIRNISFMVKRIRINTTVDEKDPSNPFRFPNIGVEK
FLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLN
TGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGMECTPGESKNLGQKENGNYIMYA
RATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGLVEEGEQCDCGYSDQC
KDECCYDANQSDDKKCKLKPGKSCSPSQGPCCTAQCNFKLKTDKCRNDSDCAREGMCNGY
SALCPASQPKQNFTECNRRTQVCIKGQCTGSICEKYDLEECTCASSDGKDDRELCHVCCM
RKMDPDTCASTGSSRWEKHFARKTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKK
AIFNPELYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPHKPLPGT
LKRRRPPQTAQPPQRQRPRESYQMGHMRH
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggatctagcgaggacgataatcctgctgtgctcctgggcggcgggcgccggaggccaa
tatggaaatcctctaaataaatacattagacattatgaaggattatcttatgatgtggat
ttgttacaccaaaaacaccagcgtgccaaaagagcagtatcgcatgaagatcagttcttg
cgcctcgactttcatgctcatggaagacaattcaaccttcgaatgaagagagatacatct
ctttttagtgaggactttaaattagaaacatcaaaccaagtaattgattatgatacctcc
catatttacactggacacatttatggtgagcagggaagttttagccatgggtctgttatt
gatggaagatttgaaggattcatccaaactcacagtgggaccttttatgttgagccagca
gagagatatattaaggacagaactctaccgttccactctgtcatctatcatgaagatgat
atcaaatatcctcataaatatggaccacaaggaggttgtgcagatcattcagtgtttgaa
agaatgcagaagtaccagatgactggtatagaagaaccaacaacagagaagccttctgaa
gagtctgacagcgacggtcctcagcttttaagaaaaaaacgtgccactcaagctgaaaaa
aacacttgtcagctgtatattcagactgatcatctgttctataaacactatggaacaagg
gaagctgtaattgcacagatatccagccatgttaaagcaattgacacaatttaccgctca
acagatttctcaggaatccgtaacatcagctttatggtgaagcgaataagaattaacaca
actgtagatgagaaggacccttcaaatcccttcaggtttcctaacattggtgtggaaaag
tttctggaactgaactcagaacagaatcatgatgattattgtttggcctatgtatttacg
gaccgtgattttgatgatggagtccttggtctagcttgggttggagccccttcaggaagc
tctggtgggatatgtgaaaagagcaaactgtattctgatggtaagaagaagtctttgaac
actggaatcatcactgttcagaactatggctctcatgttcctcccaaggtttcgcatatc
acttttgctcatgaggttggacataactttggctcacctcatgattctggaatggaatgc
actccaggggagtccaagaacttgggacagaaagaaaatgggaattatatcatgtatgca
agagctacatctggggacaaacttaataacaacaagttctcactctgtagtattcgaaat
atcagccaagttcttgagaaaaagagaaataactgctttgttgagtctggtcaacctatc
tgtggtaatggactggtagaagaaggagagcagtgtgattgtggatacagtgatcagtgt
aaagatgaatgctgttacgatgcaaaccaatcagatgataaaaaatgcaagttaaaacca
ggcaaatcctgcagccctagccaaggcccttgctgtactgcgcaatgtaatttcaaactg
aagactgataagtgccgaaatgattcggactgtgcgagggagggaatgtgtaatggttac
agtgctctctgtcctgcctctcagcctaaacagaacttcacagaatgcaacaggcgtaca
caagtttgcataaaagggcaatgtactggctctatctgtgagaagtacgacttggaggaa
tgcacatgcgctagttcagatggcaaggatgacagagaactgtgtcatgtctgctgcatg
agaaaaatggacccggatacttgtgcaagcacgggctccagccgctgggagaaacacttt
gctcgtaaaactattacgttgcaaccaggatctccttgtaatgatttcagaggctactgt
gatgtgtttatgagatgtcggctggtagatgctgatggccctctagctcggttaaagaaa
gcaatttttaatcctgagctgtatgaaaatattgcagaatggatcgtggctcattggtgg
gcagtattgcttatgggaattgccctgatcatgttaatggctggtttcattaagatatgc
agtgttcatactccaagcagtaatccaaagttgcctcctcataaaccacttccaggcact
ttaaaaaggaggagaccgccacaaactgctcagccaccacagcgacaaaggccccgagag
agctatcagatgggacatatgagacattga

DBGET integrated database retrieval system