KEGG   Gallus gallus (chicken): 374115
Entry
374115            CDS       T01006                                 

Gene name
ARNTL
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator-like protein 1
  KO
K02296  aryl hydrocarbon receptor nuclear translocator-like protein 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    374115 (ARNTL)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    374115 (ARNTL)
SSDB
Motif
Pfam: PAS_11 PAS PAS_3 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 374115
NCBI-ProteinID: NP_001001463
CGNC: 4005
Ensembl: ENSGALG00000005378
UniProt: Q9I8T7
Position
5
AA seq 633 aa
MADQRMDISSTISDFMSPDPADLISSSLSTSGVDCNRKRKGSSTDYQLDGFPFEEGMDTD
KDDQHGRLDYADQQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLT
VLRMAVQHMKTLRGATNPYTEANYKPAFLSDDELKHLILRAADGFLFVVGCDRGKILFVS
ESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDIT
PGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPP
TKMGLDEDNEPDNEGCNLSCLVAIGRLHPHVVPQPVNGEIRVKPTEYVSRHAIDGKFVFV
DQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSF
ITLRSRWFSFMNPWTKEVEYIVSTNTVVSTSVLDSGDAAFPQLAASPHSMDSVLQAGEGG
PKRSHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDTS
SPGSKKILNGGTPDISSAGLLSGQIQDSSGYPYSDNSSILGENSHIGIDMIDNDQGSSSP
SNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggcagaccaaaggatggacatttcttctacaattagtgactttatgtcaccagaccct
gctgacttgatttccagttcccttagcacttcaggagtggattgtaatcggaaaaggaag
ggaagctctactgattatcaacttgatggctttccttttgaggaaggtatggatacagat
aaagatgaccaacatggaagactggactacgcagaccaacaagggagaataaaaaatgca
agggaggctcatagtcaaattgaaaaacggcgtcgagataaaatgaacagctttatagat
gaactggcatccttggtaccaacgtgcaacgctatgtctcgaaagctagataaactcact
gtattgagaatggcagtccagcatatgaaaacattacgtggtgctacaaacccatataca
gaagccaactataagcctgcttttctgtcagatgacgaattaaagcatctaatactcagg
gcagcagatggatttctttttgttgtgggctgtgacagagggaagatactgtttgtttca
gaatctgtcttcaagatcctcaactacagtcagaatgatttaatcggtcaaagtttattt
gactaccttcatccgaaagacattgccaaagtgaaggagcagctatcttcttctgacact
gcaccacgagaaaggcttatagatgcaaaaactggactcccagttaaaactgatataaca
cccgggccatcacgactatgttctggagcaaggcggtccttcttttgtaggatgaagtgc
aacagaccttcagtgaaagtagaagacaaggattttccttccacctgttcaaagaagaaa
gcagaccgcaaaagcttctgcactatccacagtacgggatatttaaaaagctggccacca
acaaaaatgggactagatgaagataacgagccagataacgagggttgtaatttaagctgc
cttgttgcaattggtcggctgcatcctcatgtagtaccacagccagtcaacggtgagatc
agggtgaaacctacagagtacgtttctcgacatgcaatagatgggaagtttgtttttgta
gaccagagggcgacagccattctggcatacttaccccaggaacttctaggtacttcgtgt
tatgaatatttccatcaagatgatataggacatcttgcagaatgtcatagacaagttttg
cagacaagagaaaaaattacaacaaactgctacaagtttaaaataaaagacggttctttt
attaccttgaggagtcgctggttcagtttcatgaacccttggaccaaagaagtagaatac
attgtctcaacaaatactgttgtttccaccagtgtacttgatagcggagacgcagccttc
ccacagcttgcagcttctccacatagcatggacagcgtgcttcaggctggagaaggcggc
ccaaaaaggagccatcctactgtccctggaattccaggaggaacaagagctggggcagga
aaaataggaaggatgattgctgaagaaatcatggaaattcacaggataagaggatcatca
ccatccagctgtggttccagtccactgaacattaccagcacaccgccacccgatacctcc
tcccctggaagcaagaagatcctgaatggtggcactccagacatttcttcagctggacta
ctatctgggcaaatccaggatagctctggttacccatattccgataactcctctattctt
ggggagaactcccatataggcattgacatgattgacaacgatcaaggatcaagcagcccc
agcaacgacgaagcagcgatggcagtaataatgagccttcttgaagcagatgcaggtctt
ggtggccctgtagatttcagtgatttgccatggcccttgtaa

DBGET integrated database retrieval system