KEGG   Gallus gallus (chicken): 374118
Entry
374118            CDS       T01006                                 

Gene name
SUFU
Definition
(RefSeq) suppressor of fused homolog
  KO
K06229  suppressor of fused
Organism
gga  Gallus gallus (chicken)
Pathway
gga04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    374118 (SUFU)
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 374118
NCBI-ProteinID: NP_989595
CGNC: 6132
Ensembl: ENSGALG00000008096
UniProt: Q8QG94
Position
6
AA seq 484 aa
MEGTRPGGAAPAGGAGSGSGSGSSSFPSLFPPGLHGIYGECRRLYPEQPNPLQVTAILKY
WLGGPDPLDYVSMYRNIGNPALNVPEHWHYVSFGLSDLYGDNRVHEFTGTDGPSGFGFEL
TFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLT
EDPQMQPVQTPFGVVTFLQIVGVCTEELHAAQQWNGQGILELLRTVPVAGGPWLITDMRR
GETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRRL
SGKDTEQIRETLRRGLEINSKPVLPPINAQRQNGLNHDRAPSRKDSLESESSAAIIPHEL
IRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDTAITFVSTGVEGAFATE
EHPYAAHGPWLQILLTEEFVERMLEDLEDLNSPEEFKLPKEYSWPEKKLKVSILPDAVFD
NPLH
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggaaggcacgcggcctggcggggctgcccccgcgggcggggcgggctccggctcgggc
tcgggctccagctccttcccgtccctcttcccgccgggccttcacggaatctacggcgag
tgccgccgcctctaccccgagcagcccaacccgctgcaggtcaccgccatcctcaagtac
tggttggggggacccgatcctctggactacgttagcatgtacagaaacatagggaaccca
gcgctgaatgttcctgagcactggcactatgtcagttttgggttaagtgacttgtatgga
gacaacagagtacatgagtttacgggaacagatggaccaagtggttttggatttgagttg
acatttcgactaaagagagaaacgggggagtcagctccacctacctggccagcagagtta
atgcaaggcttagcaagatatgtcttccagtcagaaaacaccttctgcagcggtgaccat
gtgtcatggcacagccctttggacaacagtgagtccagaatccagcatatgttgctgaca
gaagaccctcagatgcagcctgtgcagactccttttggggttgttactttcctacagatt
gttggggtttgcactgaggaactgcatgcagctcagcaatggaacgggcaaggaatcttg
gagctgcttcggactgtcccagtagctggaggcccttggctgataacagacatgcgaaga
ggagaaacaatatttgaaattgacccgcatctgcaagagagagtcgacaaagggattgag
acagatggctcaaacctaagtggagtgagtgccaaatgtgcctgggatgatctcagccgg
ccccctgaggatgacgaagacagcaggagcatttgcatcggaacccagccgcggcggctc
tccgggaaagatacggagcaaatcagggagactttgcgaagagggctggagattaacagc
aaacctgttctacctccaataaatgcacaaagacagaatgggttgaaccatgaccgagca
ccaagccggaaggacagtttagaaagcgagagctcagcagctatcattcctcatgagcta
atccgcacgagacagctggaaagcgtacacctgaagtttaaccaggagtctggagcgctg
attcccctctgcctaaggggaaggctcttacatggacggcactttacatataaaagtatt
acaggggacacagcaatcacgtttgtatcaacgggagtagaaggagcatttgctacagag
gagcacccctatgcagcacatggaccttggttacaaatcctattgactgaagagttcgta
gagagaatgctggaagatttagaagatctgaattctccagaggaatttaaacttccaaag
gagtacagctggcctgaaaagaaactgaaagtctccatcttgccagatgctgtgttcgac
aacccgctgcattag

DBGET integrated database retrieval system