KEGG   Gallus gallus (chicken): 374127
Entry
374127            CDS       T01006                                 

Gene name
PAX3
Definition
(RefSeq) paired box protein Pax-3
  KO
K09381  paired box protein 3/7
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    374127 (PAX3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box plus homeo domain
    374127 (PAX3)
SSDB
Motif
Pfam: PAX Pax7 Homeodomain HTH_23 Homeobox_KN HTH_Tnp_IS1
Other DBs
NCBI-GeneID: 374127
NCBI-ProteinID: NP_989600
CGNC: 3903
Ensembl: ENSGALG00000030944
UniProt: Q8QGS3
Position
9
AA seq 484 aa
MTTLAGAVPRMMRPGAGQSYPRGGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIV
EMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPKQVTTPDVEKKIEE
YKRENAGMFSWEIRDRLLKDGVCDRNTVPSVSSISRILRSKFGKGEEEEAELERKEAEEG
DKKAKHSIDGILSERASAAQSDEGSDIDSEPDLPLKRKQRRSRTTFTAEQLEELERAFER
THYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQAGANQLMAFNHLIPGGFPPSAMP
TLPTYQLSEPSYQPTSIPQAVSDPSSTVHRPQPLPPSTVHQSSLPSNPESSSAYCLPSTR
HGFSSYTDSFVPPSGPSNPMNPAIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLE
PTTTVSASCSQRLDHMKSLDSLPTSQSYCPPTYSTTGYSMDPVTGYQYGQYGQSAFHYLK
PDIA
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgaccacgctggccggggccgtgcccaggatgatgcggcccggagccgggcagagctac
ccgagaggaggcttcccgttggaagtctctacccctctcggccagggcagagtcaatcag
ctcggaggagtgttcatcaacgggcggccgctgcccaaccatatccgccacaagatcgtg
gagatggcgcaccacggcatccggccctgtgtcatctcccggcagctgcgcgtgtcccac
ggctgcgtctccaagatcctctgccgctaccaggagacgggatccatccgcccgggggcc
atcggcggcagcaaacccaagcaggtgacgacgccggacgtggagaagaaaatcgaggag
tacaagcgggagaacgcggggatgttcagctgggagatccgcgacaggctgctcaaggac
ggcgtctgcgaccgcaacaccgtgccctcagtgagctccatcagccgcatcctgcggagc
aagttcgggaaaggcgaggaggaggaggccgagctggagaggaaggaggcggaggaagga
gacaagaaggcgaagcacagcatcgacggcatcctcagcgagagagcatcagcagcccag
tctgatgaaggctctgatatcgattctgaaccagacttacccttaaaaagaaagcagcgt
cgcagcaggacaaccttcacagcagagcaactggaagagctggaaagagcttttgagagg
acacactaccctgacatttatactcgggaagaactcgcacaaagagccaaactcacggaa
gctcgagttcaggtttggtttagcaaccgccgtgctagatggaggaagcaggcaggagcc
aaccaactgatggcttttaaccacctgatcccaggagggtttccacccagcgccatgccg
actctgccgacataccagctctctgagccatcctatcagcccacctccataccgcaagcc
gtgtctgatccaagcagtacagtccatagacctcagcctctccctccaagcactgtacac
caaagcagcctcccttcaaacccagagagcagctctgcctattgcctacccagcaccagg
catggattttccagctatacagacagctttgtgcctccgtccgggccctcaaatcccatg
aaccctgccattggcaatggcctttcacctcaggtaatgggactcttgactaaccatggt
ggtgtgcctcaccagccccaaactgattatgccctgtcccctttgactggaggtctggag
cccaccaccactgtctcagccagctgcagtcagcggctagatcacatgaagagtttagac
agcctgcctacatcacagtcctactgcccaccgacctatagcaccaccggctacagcatg
gaccctgtcaccggctaccagtatggacagtatggacaaagtgcctttcattatctgaag
ccagatatcgcataa

DBGET integrated database retrieval system