KEGG   Gallus gallus (chicken): 374129
Entry
374129            CDS       T01006                                 

Gene name
LMO2
Definition
(RefSeq) rhombotin-2
  KO
K15612  rhombotin-2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    374129 (LMO2)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 LIM domain-containing proteins
  Nuclear LMO family proteins
   374129 (LMO2)
SSDB
Motif
Pfam: LIM C1_4 TDH
Other DBs
NCBI-GeneID: 374129
NCBI-ProteinID: NP_989602
CGNC: 66186
Ensembl: ENSGALG00000029892
UniProt: Q71LH8
Position
5
AA seq 158 aa
MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLC
GCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECF
KCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI
NT seq 477 nt   +upstreamnt  +downstreamnt
atgtcatcggccatcgagaggaagagcctcgatccttccgaggagccggtggatgaggtg
ctgcagatccccccctcgctgctgacatgcgggggctgccagcagaacatcggggaccgc
tatttcctgaaggccatcgaccagtactggcacgaggactgcctcagctgcgacctgtgc
ggctgccggctgggagaggtggggcggcggctgtactacaagctgggcaggaagctctgc
cggagggactatctcaggctctttggccaagatggcctctgtgcctcctgtgacaaacgg
atccgggcttatgagatgaccatgcgggtgaaggacaaagtgtatcacctcgaatgcttc
aaatgcgcggcctgccagaaacacttctgtgttggggacagatacctcctgatcaactcg
gacatagtatgtgaacaggacatctatgagtggactaagataaatggaatgatatag

DBGET integrated database retrieval system