KEGG   Gallus gallus (chicken): 374142
Entry
374142            CDS       T01006                                 
Symbol
WNT3
Name
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
gga04310  Wnt signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    374142 (WNT3)
   04150 mTOR signaling pathway
    374142 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    374142 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    374142 (WNT3)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Morphogens
   374142 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 374142
NCBI-ProteinID: NP_001075165
CGNC: 49060
Ensembl: ENSGALG00000001079
UniProt: A1DYI3
Position
27:3523292..3544335
AA seq 355 aa
MDYHLLGLILSFLFNGTKVLAGYPIWWSLALGQQYSSLGSQPILCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNRHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDYLKDKYDS
ASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRVYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggattaccacctgcttggattaattttgtcttttctcttcaatggcacaaaggtctta
gcgggttaccccatttggtggtcccttgctctcggccagcagtacagctccctggggtct
cagcccatcctctgcggctccatccccggcctcgttcccaagcagctccgcttctgccgc
aactacatcgagatcatgcccagtgtggccgagggggtgaagttgggcatccaggagtgc
cagcatcagttccgagggcgccgctggaactgcaccaccatcgatgacagcctggccatc
tttgggcctgtcctggacaaagccacacgggagtctgcgtttgtccacgccatcgcgtca
gccggcgttgcctttgctgtgacccgctcctgcgccgagggcacgtccaccatctgcggc
tgtgactcccaccacaaagggcctccaggagagggctggaaatggggtggatgcagcgag
gatgccgactttggtgtgttggtgtcccgggaattcgcagacgctcgagagaaccgtccg
gacgcacgctcggccatgaacagacacaacaacgaggccgggaggacgaccattctggac
cacatgcacctgaagtgcaagtgccacgggctctcgggaagctgcgaggtcaagacttgc
tggtgggcacagcccgactttcgggccatcggggattacctgaaggataaatacgacagt
gcttccgagatggtggtggagaagcaccgggagtcccggggttgggtagaaactcttcgg
gctaagtatgctcttttcaagccaccaacagagcgggatttggtttactatgagaactcc
ccgaatttctgcgagcccaacccagagacgggctcctttgggacaagggacagaacgtgc
aacgtcacctcccatgggattgatggctgtgacctgctgtgctgcggtcggggccacaac
accaggactgagaaaaggaaggagaagtgccactgcatcttccactggtgctgctatgtg
agctgccaggagtgcatacgtgtctacgacgtccatacctgcaagtaa

DBGET integrated database retrieval system