KEGG   Gallus gallus (chicken): 374146Help
Entry
374146            CDS       T01006                                 

Gene name
ERG
Definition
(RefSeq) transcriptional regulator Erg
  KO
K09435  transcriptional regulator ERG
Organism
gga  Gallus gallus (chicken)
Brite
Transcription factors [BR:gga03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    374146 (ERG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT SAM_2 SAM_1
Motif
Other DBs
NCBI-GeneID: 374146
NCBI-ProteinID: NP_989611
CGNC: 49062
Ensembl: ENSGALG00000016058
UniProt: Q90837
Position
1
AA seq 478 aa AA seqDB search
MASTIKEALSVVSEDQSLFECAYGSPHLAKTEMTASSSSEYGQTSKMSPRVPQQDWLSQP
PARVTIKMECNPNQVNGSRNSPDDCSVAKGGKMVSSSDNVGMNYGSYMEEKHIPPPNMTT
NERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVDILLFQNIDGKELCKMTKDDFQRLT
PSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGATFIFPNTSVYPEA
TQRITTRPDLPYEQARRSAWTSHSHPTQSKATQPSSSTVPKTEDQRPQLDPYQILGPTSS
RLANPGSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMN
YDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSMYKYPSDLPYMSSY
HAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPAAHMPSHLGTYY
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcactattaaggaagcattatcagtggtgagtgaagaccagtccttgtttgag
tgtgcctacggatcgccccaccttgcaaagacagaaatgacagcctcctcttccagtgaa
tatgggcaaacatcaaagatgagcccgcgcgttccccagcaggactggttatcacagccc
ccggccagagttaccattaagatggagtgtaacccaaaccaggttaatgggtcaaggaat
tcacctgatgactgcagcgtggcaaaaggagggaaaatggttagcagttcagacaatgtt
gggatgaactatggaagctacatggaagagaagcatattccgcctccaaatatgacaacc
aatgaacgaagagttattgtgccagcagatcctacgttatggagcacagaccatgtacgg
cagtggctggagtgggcagtgaaggagtatggtcttccagacgtggacatcttgttgttc
cagaacattgatgggaaagagttgtgtaaaatgaccaaagatgacttccagagactcacg
ccgagctataacgcagatatcctcctgtcacacctacactacctcagagagactcctctt
ccacatttgacttcagatgatgttgataaggccttacaaaactctccacggttaatgcat
gctagaaacacaggaggagccacttttatttttccaaatacatcagtttacccagaagca
acgcaaagaataacaacaaggccagatttaccttatgagcaagcgaggagatcagcgtgg
acgagtcacagccatcccactcagtcaaaagctacccaaccatcatcttcaacagtgccc
aaaacagaagaccagcgtcctcagttagatccttatcagattcttggaccgaccagcagc
cgtcttgcaaatccagggagtgggcagatacagctatggcagttcctactggagcttctg
tcggacagctccaactccaactgcatcacctgggagggcacaaatggggagttcaagatg
acagaccctgatgaagtggctcggcgttggggagagaggaaaagcaaacctaacatgaac
tatgacaaactcagccgtgcacttcgctactactatgacaaaaatattatgactaaagtt
catggtaaacgctatgcctacaaatttgatttccacggaatcgctcaggccctccagcct
caccctccagaatcatccatgtacaaatacccatcagacctcccctacatgagttcctac
catgcacacccccagaagatgaactttgtagctccccatccccctgctttgcccgtaacc
tcatccagcttttttgctgcccctaatccatactggaattcaccaactggaggcatctac
cccaataccaggctgccagctgctcatatgccttcccatcttggcacctactactaa

DBGET integrated database retrieval system