KEGG   Gallus gallus (chicken): 374148Help
Entry
374148            CDS       T01006                                 

Gene name
SOX9
Definition
(RefSeq) transcription factor SOX-9
  KO
K18435  transcription factor SOX9 (SOX group E)
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    374148 (SOX9)
Transcription factors [BR:gga03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    374148 (SOX9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box Sox_N HMG_box_2
Motif
Other DBs
NCBI-GeneID: 374148
NCBI-ProteinID: NP_989612
CGNC: 49063
Ensembl: ENSGALG00000004386
UniProt: P48434
Position
18
AA seq 494 aa AA seqDB search
MNLLDPFMKMTEEQDKCISDAPSPTMSDDSAGSPCPSGSGSDTENTRPQENTFPKGDPDL
KKESDEDKFPVCIREAVSQVLKGYDWTLVPMPVRVNGSSKNKPHVKRPMNAFMVWAQAAR
RKLADQYPHLHNAELSKTLGKLWRLLNESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRK
SVKNGQSEQEEGSEQTHISPNAIFKALQADSPQSSSSISEVHSPGEHSGQSQGPPTPPTT
PKTDAQQPGKQDLKREGRPLAEGGRQPPHIDFRDVDIGELSSDVISNIETFDVNEFDQYL
PPNGHPGVPATHGQVTTYSGTYGISSSASSPAGAGHAWMAKQQPQPPQPPAQPPAQHTLP
ALSGEQGPAQQRPHIKTEQLSPSHYSEQQQHSPQQQQQQQQQLGYGSFNLQHYGSSYPPI
TRSQYDYTEHQNSGSYYSHAAGQSGGLYSTFTYMNPTQRPMYTPIADTSGVPSIPQTHSP
QHWEQPVYTQLTRP
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcctagaccccttcatgaaaatgacagaagaacaggacaaatgcatctccgac
gcccccagccccaccatgtcggatgactccgccgggtccccctgcccctccggatccggc
tcggacacggagaacacccgacctcaagagaacaccttccccaaaggcgacccggacctg
aagaaggagagcgacgaggacaaattccccgtgtgcatccgcgaggccgtgagccaggtg
ctcaagggctacgactggaccctggtgcccatgcccgtgcgggtgaacggatccagcaag
aacaaaccccacgtgaagcgccccatgaacgccttcatggtgtgggcccaggcggctcga
aggaagctggctgaccagtacccgcatctgcacaacgccgagctcagcaagacgctgggc
aagctgtggaggctgctgaatgagagcgagaagcgtcccttcgtggaggaggccgagcgg
ctgcgggtgcagcacaagaaggaccaccccgactacaagtaccaaccacgcaggaggaag
tcggtgaagaacgggcagtcggagcaggaggagggctccgagcagacccacatctccccc
aacgccatcttcaaggcgctgcaggcggactccccgcagtcatcctccagcatcagcgag
gtgcactcccccggggagcactcagggcagtcgcagggcccccccacgccccccaccacc
cccaaaacggacgctcagcagccgggcaagcaggacctgaagcgcgagggccgccctttg
gcggaaggcggccgccaacctccccacatcgatttccgagacgtggacatcggcgagctc
agcagcgacgtcatctccaacatcgaaaccttcgacgtcaacgagttcgaccaatacctg
ccccccaacggccacccgggggtcccggccacccacggccaggtcaccacctacagcggt
acctacggcatcagcagctcggccagctctccggcgggcgccgggcacgcctggatggcc
aagcagcagccgcagcccccacagcccccagcacagcccccggcacagcacacactgcca
gcactgagcggtgagcagggtccggcacagcagcggccgcacatcaaaacagagcagctg
agccccagccactacagcgagcagcagcagcactccccgcagcagcagcagcagcagcaa
cagcagctgggctacggctccttcaacctgcagcactacggctcctcgtacccccccatc
acccgctcgcagtacgattacaccgagcaccagaactccggctcctactacagccacgcc
gccgggcagagcggaggcctctactccaccttcacctacatgaaccccacgcagcgcccc
atgtacacccccatcgcagacacgtcgggggtgccctctatcccgcagacccacagcccg
cagcactgggaacagcccgtctacacgcagctcacccggccttaa

DBGET integrated database retrieval system