KEGG   Gallus gallus (chicken): 374156
Entry
374156            CDS       T01006                                 

Gene name
DKK1
Definition
(RefSeq) dickkopf-related protein 1
  KO
K02165  dickkopf
Organism
gga  Gallus gallus (chicken)
Pathway
gga04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    374156 (DKK1)
SSDB
Motif
Pfam: Dickkopf_N Prokineticin
Other DBs
NCBI-GeneID: 374156
NCBI-ProteinID: XP_015134195
CGNC: 2791
Position
6
AA seq 231 aa
MRALLALLAALSCAGRAGAGGGLSSNAIKVGAAASAAPAAAAPAPFDGSNKAPPAATRQP
FPCSEDEDCGPDEFCGGAARGGGPPLCLACRRRRKRCLRDAMCCPGTACSNGLCTPPEPP
PGAPELDEPGPEALPRRTPAPAWPPDAKGEEGDFCLRSSDCAAGLCCARHFWSKICKPVL
REGQVCTRHRRKGAHGLEIFQRCPCAEGMACRPQRDRGGPDASRLHTCQRH
NT seq 696 nt   +upstreamnt  +downstreamnt
atgcgggctctgctggcgctgctggcggccctgagctgcgcggggcgggcgggggccggc
ggcggcctcagctccaacgccatcaaggtgggggcggccgccagcgccgcccccgccgcc
gccgcccccgcgcccttcgacggtagcaacaaggcgccgccggccgccacccggcagccc
ttcccctgctccgaggacgaggactgcggccccgacgaattctgcggaggggcggcccgc
ggcggcggccccccgctctgcctcgcgtgcaggagacgccgcaagcgctgcctgcgcgac
gccatgtgctgcccgggcacggcctgcagcaacgggctctgcacgccccccgaacccccg
cccggagctcccgagctggacgagcccggccccgaggcgctgccccgacggacgcccgcg
cccgcctggccgcccgacgccaaaggtgaggagggcgacttctgcctgcgctcgtcggac
tgcgcggcggggctgtgctgcgcccgccacttctggtccaagatctgcaaacccgtgctg
cgcgaggggcaggtgtgcacccggcaccgccggaaaggagcccacggcctcgagatcttc
cagcgctgcccctgcgccgagggcatggcgtgccgcccgcagcgcgaccgcggcggtccc
gacgcctcccgcctgcacacttgccagcggcactga

DBGET integrated database retrieval system