KEGG   Gallus gallus (chicken): 374157
Entry
374157            CDS       T01006                                 

Gene name
NRP2
Definition
(RefSeq) neuropilin-2 precursor
  KO
K06819  neuropilin 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    374157 (NRP2)
Membrane trafficking [BR:gga04131]
 Autophagy
  Other autophagy associated proteins
   Others
    374157 (NRP2)
SSDB
Motif
Pfam: CUB F5_F8_type_C DUF3481 MAM
Other DBs
NCBI-GeneID: 374157
NCBI-ProteinID: NP_989615
CGNC: 6545
Ensembl: ENSGALG00000008621
UniProt: Q8UVQ9
Position
7
AA seq 936 aa
MDTFLLAWGFLGLCLPGSGGAAETAQPCGGRLNSKDAGYITSPGYPNDYPSHQNCEWVIY
APEPNQKIILNFNPHFEIEKHDCKYDFIEIRDGDSEAADLLGKHCGNIAPPTIISSGSSL
YIKFTSDYARQGAGFSLRYEIYKTGSEDCSRNFTASNGTIESPGFPDKYPHNLDCVFTII
AKPKTEILLHFVLFDLEHDPLQAGEGDCKYDWLDIWDGIPQVGPLIGRYCGTKMPSDIRS
TTGVLSLTFHTDLAVAKDGFSAQYYLIQQEVPENFQCNVPLGMESGRISNMQISASSTYS
DGRWTPQQSRLNSDDNGWTPNVDSNKEYLQVDLHFLTVLTAIATQGAISRETQNGYYVRT
YKLEVSTNGEDWMMYRHGKNHKTFQANEDATEVVLNKIHSPVLTRFVRIRPQSWHNGIAL
RLELYGCRITDSPCSNLLGMLSGLIPDSQISASSIRGYDWSPSMARLVSSRSGWFPRIPQ
AQPGEEWLQVDLGVPKNVKGVIIQGARGGDSVTTTESRSFVKKFKVAYSMNGKDWEFIQD
PKTMQAKLFEGNIHYDIPEIRRFDPVPAQYVRVHPERWSPAGIGMRLEVLGCDWTDVKPT
AETLVPTLKSEETTTPYPTDEEATECGDSCGEEEDFHLPANFNCNFDLPEDLCGWSHDSA
TGYTWSFQPASTWMGNSEPSPETLPDAKSYLRLQSSGRRESQRARLISPTIYLPRSAVCM
VFQYQVWGSSGVMLRVWREASQEHKALWVIAEDQGKEWREGRIILPSYDMEYRIVFEGFI
RNGHAGELALDDIRLGNDIPLEYCMEPITAFPVNFPRMKDDFPIPEQDFEDSDDTDYFGS
DKNDTLFSTNSPGNSKLDKEKSWLYTLDPILVTIIAMSSLGVLLGAICAGLLLYCTCSYA
GLSSRSSTTLENYNFELYDGIKHKVKMNHQKCCSEA
NT seq 2811 nt   +upstreamnt  +downstreamnt
atggatacgtttcttttggcgtggggatttctagggctgtgcttgcccggctccggaggc
gcggcggagacagctcagccgtgtgggggccgcctgaactccaaggacgccgggtacatc
acctccccaggctaccccaatgactacccctcccaccagaactgcgagtgggtcatctac
gctcctgagcccaaccagaagattatcctcaacttcaaccctcacttcgaaatcgaaaag
catgattgcaagtatgacttcattgagatccgagatggagacagcgaagcagccgacctg
ctgggcaagcactgcgggaacatcgcacctcctaccatcatctcgtcaggctcctctctc
tacatcaagttcacctcggactacgcgcggcaaggggccggcttctccctgcgctatgag
atctacaagacaggctctgaggactgttccagaaacttcactgcctccaatggtactatt
gagtctccaggtttccctgacaaatatccacacaacctggactgcgtcttcaccatcata
gccaagccaaagacagaaatcctcctccactttgtgctctttgacctcgagcatgaccct
ctgcaggcaggggagggagactgcaagtatgactggctggacatctgggacggcatccct
caagttggccctttgataggcaggtactgtggcactaagatgccatcggacatccgctcg
accaccggcgtcctgtctctcaccttccacactgacctggctgtggctaaagatggtttc
tctgctcagtactacttgatccaacaggaggtgcctgaaaacttccagtgcaatgtgccg
ctggggatggagtctggcaggatctccaacatgcagatcagtgcctcctccacctactca
gatgggcgatggacgccccagcagagccggctcaacagcgatgacaacggctggaccccc
aatgtagacagcaacaaagagtacctccaggtggacctccacttcctgactgtgctcaca
gccattgctacacagggtgccatctccagagaaacccagaatgggtactatgtccgtact
tacaagctggaggtcagcaccaacggggaggactggatgatgtaccgacatggtaaaaac
cacaagacgtttcaggccaatgaggacgccacggaggtggttctcaacaagatccacagc
ccagtgctcacacgctttgtgcgcatccgtccccagagctggcacaacggcatcgccctg
aggctggagctgtatggctgccgcatcaccgattcgccctgctccaacttgctggggatg
ctttctggcctcatccctgactcgcagatctcggcctcttctatcagaggctacgactgg
tcccccagcatggcccgcttggtgagcagccgttcaggctggtttccacgcatcccccaa
gcccagcctggggaggagtggctgcaagtggacctgggcgtcccaaagaacgtcaaaggc
gtcattatccagggggctcgcggaggggacagcgtgaccaccaccgagtcccgctccttc
gtgaagaagtttaaggtagcctacagcatgaatggaaaggactgggaattcatccaggac
cccaagacgatgcaggccaagctctttgaaggcaacatccattatgatatccctgaaatc
cggaggtttgaccccgttcctgcccagtacgtccgagtgcacccagagaggtggtcccca
gcaggaataggaatgcgtctggaagtgttgggatgcgattggacagacgtgaagcccact
gcagagacactggtgcccactttgaagagcgaagagaccaccaccccatatccaactgat
gaagaggcgactgagtgtggtgatagctgtggagaagaggaagatttccatcttcctgca
aacttcaactgcaactttgatctccctgaagacctgtgtggttggtcacacgactcggca
acgggctacacgtggtcttttcagcctgcaagcacctggatgggcaactctgaaccaagt
cccgagactctgcctgatgccaagagctacctgcggctgcagagcagtgggaggagggaa
agccagcgcgcccggctcatcagccccaccatctacctgccccgcagcgccgtctgcatg
gtgttccagtaccaggtgtggggcagcagtggagtgatgctgcgggtctggcgggaggcc
agccaggagcacaaggcgctgtgggtcatcgcagaggaccagggcaaggagtggagggag
ggccgcatcatcctgcccagctacgacatggagtaccggatagtgtttgagggatttata
cgcaatggccacgcaggagagctcgccctggatgacatccggctgggcaacgacatcccc
ctggagtactgcatggaacccatcacagctttcccagtgaacttcccaagaatgaaggat
gacttcccgatccctgagcaagactttgaagacagcgatgatactgattactttggatcg
gataagaacgacaccctgttctctactaactctccaggaaactcgaagctggacaaagaa
aaaagctggctctacactctggatcccatcctggtgaccatcatagcgatgagctctctc
ggcgtccttctcggagccatctgtgctggtctgctgctctactgcacgtgctcatacgcg
gggctgtcctcacggagctccaccacgctggagaactacaattttgagctgtacgacggt
atcaagcacaaggtcaagatgaaccaccagaagtgctgctccgaggcatga

DBGET integrated database retrieval system