KEGG   Gallus gallus (chicken): 374168
Entry
374168            CDS       T01006                                 

Gene name
WNT7A
Definition
(RefSeq) protein Wnt-7a
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
gga04310  Wnt signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    374168 (WNT7A)
   04150 mTOR signaling pathway
    374168 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    374168 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    374168 (WNT7A)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Morphogens
   374168 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 374168
NCBI-ProteinID: NP_989623
CGNC: 3813
Ensembl: ENSGALG00000005123
UniProt: Q9DEB8
Position
12
AA seq 349 aa
MNRKTRRWIFHIFLSLGIVYIKIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGINECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHKEEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPKFRELGYILKDKYNEAVQVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRMCNKTAQQ
SNGCDLMCCGRGYNTHQYSRVWQCNCKFHWCCYVKCNTCSERTEVYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaacaggaaaacaaggcgctggattttccacatcttcctgagcctggggattgtgtat
atcaagatcgggggtttttcctctgtggtggccctgggagccagcatcatctgcaacaag
atcccgggtctcgccccccggcagcgggcgatctgccagagcaggcccgacgctattatc
gtcatcggggaagggtcccagatgggcatcaacgagtgccagttccagtttcgcaatggg
cgctggaactgctctgccctgggagagaggaccgtcttcggcaaggagctgaaagtgggt
agcagagaagcagccttcacctacgccatcattgctgccggagtagcccacgccatcacg
gctgcctgcacacagggaaacctgagcgactgtggctgtgacaaagagaagcagggacag
taccacaaggaggaaggatggaaatggggcggctgctccgccgacatcagatacggaata
ggattcgccaaagtgtttgtggatgcccgggagattaagcagaacgcgcggacgctgatg
aacctgcacaacaatgaggccgggcgcaagattctggaagagaacatgaagttagagtgc
aaatgccatggggtctcgggatcctgtaccactaaaacatgctggacaactctgccgaaa
ttccgggagctgggctacatccttaaggacaaatacaacgaagcagttcaagtcgaacca
gtgagggcaagtcgcaacaagcgtccaaccttcctcaaaataaagaagccactttcgtat
cgcaaacccatggatacagatttagtgtacatagaaaaatctcccaattattgtgaagaa
gaccccgtcacgggcagcgtgggaacgcaggggaggatgtgcaacaagacggcccagcag
tccaatggctgcgacctgatgtgctgcggtcgaggttacaacacgcaccagtactcgaga
gtgtggcagtgcaactgcaaatttcattggtgctgctatgttaaatgtaacacatgcagt
gaaagaacagaagtatatacctgtaagtga

DBGET integrated database retrieval system