KEGG   Gallus gallus (chicken): 374178
Entry
374178            CDS       T01006                                 

Gene name
TIMP2
Definition
(RefSeq) metalloproteinase inhibitor 2 precursor
  KO
K22583  metalloproteinase inhibitor 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    374178 (TIMP2)
Peptidases and inhibitors [BR:gga01002]
 Peptidase inhibitors
  Family I35: timp family
   374178 (TIMP2)
SSDB
Motif
Pfam: TIMP NTR
Other DBs
NCBI-GeneID: 374178
NCBI-ProteinID: NP_989629
CGNC: 49073
Ensembl: ENSGALG00000027070
UniProt: O42146
Position
18
AA seq 220 aa
MPGAALPSLLAWLAVLLLGRARPADACSCSPIHPQQAFCNADVVIRAKRVSAKEVDSGND
IYGNPIKRIQYEVKQIKMFKGPDQDIEFIYTAPSTEVCGQPLDTGGKKEYLIAGKSEGDG
KMHITLCDLVATWDSVSPTQKKSLNQRYQMGCECKISRCLSIPCFVSSSDECLWTDWAME
KIVGGRQAKHYACIKRSDGSCAWYRGMAPPKQEFLDIEDP
NT seq 663 nt   +upstreamnt  +downstreamnt
atgcccggggccgcgctgcccagcctgctggcctggctggcggtgctgctgctcggcagg
gcccgcccggccgacgcgtgcagctgctcgcccatccacccgcagcaggccttctgcaac
gccgacgtagtgatccgagcaaagcgcgtctcggcgaaggaggtggattcagggaatgac
atttatgggaaccccatcaagcgaatccagtacgaagtgaagcagatcaagatgtttaag
ggccccgaccaggacatcgaattcatctacacggcgccgtccaccgaggtgtgtgggcag
cctctggacacaggaggtaagaaggagtacctgattgcaggcaaatccgagggcgatggc
aagatgcacatcacgctgtgtgacctggttgccacctgggactcggtgagccccacccag
aagaagagcctcaaccagcggtaccagatgggctgcgagtgcaagatctcgcgctgcctc
tccatcccctgcttcgtctcctcctcggatgagtgcctctggacagactgggcgatggag
aagatcgtgggcgggcggcaggccaagcactacgcctgcatcaagaggagcgacggctcg
tgcgcctggtaccgcggcatggcccccccgaagcaggagtttctcgacatcgaggacccc
taa

DBGET integrated database retrieval system