KEGG   Gallus gallus (chicken): 374180Help
Entry
374180            CDS       T01006                                 

Gene name
ENAH
Definition
(RefSeq) protein enabled homolog
  KO
K05746  enabled
Organism
gga  Gallus gallus (chicken)
Pathway
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    374180 (ENAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH1 VASP_tetra
Motif
Other DBs
NCBI-GeneID: 374180
NCBI-ProteinID: NP_989631
CGNC: 7070
Ensembl: ENSGALG00000009303
UniProt: Q90YB5
Position
3
AA seq 784 aa AA seqDB search
MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVI
NCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQEAVFYL
GPTLPRQNSQLPAQVQNGPSQEELDIQRRQLQEQQRQKELERERLDRERMERERLERERL
ERERLERERLEQEQLERERQERERQERLERERQEKERQDRERLERLERERQERERQEQLE
REQLEWERERRISNAAPSFDNSPYSTPLPEYSSCQPPSAPPPSYAKAVSAPMSEATPEYA
VVTSAPPTSTPPTPPLRHSASRFATSLGSAFHPVLPHYATVPRPLNKSSRPPSPVNAPAT
LPPNPKPVAWSAPSFAPLPPSPPVMISSPPGKATGPRPVLPVSASNPVAQMPASPTAPNG
LSENVTYAVPSPSTSGPTPPPPPPPPPLPSFPPLSLSGPQASPSPNSPNASTPSSKPSVL
PSPSAATPASVENSLNSVLGDSSASEPVLQAASQPIEPTTQQGVVQGPPAPPPPPPLPPG
PAQASVAAPPPPGPPPPPPPLPPSGPPPPPPPPPLPSQAPTVPLPPPAPPLPASGFSAGF
VSEENRPLTGLAAALAGAKLRKVSRGEDSSSSSGGGGSAPSKTDSGRGNGPLPLGGSGLM
EEMSALLARRRRIAEKGSTEPEQKEDKTEEAESSTSKASSTSTPELTRKPWERTNTVNGS
KSPVISRPKSTTTGQPSANGVQSEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSK
SNTA
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacagagtatctgccaagcacgagctgctgtaatggtctatgatgatgccaat
aagaaatgggtaccagctggtggatcaactggattcagcagagttcacatatatcatcac
acaggcaacaacacattcagagtcgtgggcaggaagattcaagatcatcaggtggtaata
aactgtgccattccaaaagggctcaagtacaatcaggctacacagaccttccatcaatgg
cgtgatgctagacaagtgtatggtctgaattttggcagcaaagaagatgccaatgtcttc
gcaagtgccatgatgcatgccttagaagtattaaattcacaggaagctgtgttctattta
ggtcctacactgcctcgacagaattcacagcttcccgctcaagtacaaaatggtccatca
caagaagaattggacatccagagaagacagttgcaagagcaacaaaggcagaaggagctg
gaacgggagaggctggatcgtgaacgaatggaacgggagaggctggagagagagaggcta
gaaagggaaagacttgaaagagagcgcctagaacaggaacaactggagagagaacgccaa
gaaagggaacgacaagagcgcctagaaagggagagacaggaaaaggagaggcaggaccga
gaaagacttgaacgacttgaacgggaaaggcaagagagagaacgacaagaacagttggaa
agggaacaattggaatgggaaagagagagaagaatttcaaatgctgctccatctttcgac
aactccccgtatagcactccacttcctgaatactccagttgccagcctccttcagcacct
cctccatcatatgcaaaagcagtctcagcaccaatgtcagaggccacaccggagtatgct
gtagtgacttctgcaccaccgacttccactccccctacaccgcctctaaggcactctgca
tcgcgttttgctacatctttaggctcagctttccacccagttcttccccattacgctacg
gttcctcgtccactgaacaaaagttctcggcccccttctcctgtgaatgccccggcgacg
ttacctccaaacccaaagccagttgcctggtctgcgcccagttttgccccgcttccccca
tcacctccagtaatgataagcagtccgccaggcaaagccaccggtccaagaccagtcctc
ccagtgtcggcttctaatccagtggctcaaatgcctgcatctcccacagctcctaatggg
ctttctgagaatgtgacttatgcggttccttcaccttctacctcaggtccaactccacct
ccgccgcctcctcccccaccactgccttcctttccgcctctgtcactctctggacctcaa
gcttctccttctccaaactcccctaatgcctcgactccctcatccaagcctagtgttctc
ccttctccctctgcagctacccctgcctctgttgagaactctctaaactctgtgctggga
gactcctctgcttctgagccagtcttgcaggcagcctctcagccgattgaacctacgacc
cagcagggtgttgtccaaggaccacctgcacctcctcccccacccccgctgcccccgggc
ccagcccaggcctcagtagcagccccgccacctcccggcccaccgccaccgccaccacct
ctccctccatcagggcctccaccaccgccaccacctcctccgcttcccagccaagctccc
actgttcccctcccacctcctgctcccccccttcctgcttcggggttttcagctggattt
gtgtctgaagaaaatcgccctctaactggactagcagctgcacttgctggagccaagctt
aggaaagtatcacggggtgaagactcctccagttcaagtggaggaggaggctctgctcca
tctaaaacagacagtggccgtggaaatgggccgcttcccttgggaggcagtggcttaatg
gaagaaatgagtgccctgctggccaggaggagaagaattgctgaaaagggatcaacagaa
ccagagcagaaagaagataaaactgaagaagcagagtcttcaacctctaaggcttcttca
acaagtacacctgaattaacaagaaagccttgggaaagaacaaatacagtaaatggaagc
aagtcgcctgttatatccagaccaaaatctacaacaacggggcaacccagtgccaatgga
gtacagtcagaaggtctagattatgacagattgaagcaggatattttagatgaaatgaga
aaggagttaacgaaattaaaggaagaactcattgatgctatcaggcaggaactgagcaag
tcgaatactgcatag

DBGET integrated database retrieval system