KEGG   Gallus gallus (chicken): 374185
Entry
374185            CDS       T01006                                 

Gene name
IRX1
Definition
(RefSeq) iroquois-class homeodomain protein IRX-1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Homeobox_KN Homeodomain Dicty_REP MRP-S32 EF-1_beta_acid
Other DBs
NCBI-GeneID: 374185
NCBI-ProteinID: NP_001025509
CGNC: 9961
Ensembl: ENSGALG00000030991
UniProt: Q9I9C5
Position
2
AA seq 467 aa
MSFPQLGYPQYLSASQAVYGSERPGVLAAAAAAAAAAAAASGRPAGAELGSGSAAVTSVL
GMYAGPYSAPNYSAFLPYTADLGLFSQMGSQYELKDNPGVHPATFAAHTAPGYYPYGQFQ
YGDPGRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR
LKKENKVTWGSRSKDQEDANLFGSDNEGDPEKTEDDEEIDLESIDIDKIDENDGEQSNEE
EEEKPELLRQSSEEERLEKDKELSLSGSEGLKPKDALAMVKEASDNSTRIISPGGQSNLQ
MPSHSKPKIWSLAETATSPDGALKSSPPPPPPAQVTHTLPQIQHPAFLPSHGLYTCQIGK
FHNWTNGAFLTQSSLLNVRSFLGVNHHHATHHNHHLQAQQQPSVLTATLGALSSEKPSER
TSPKHIENVPRTDSPPQPLKSPFQPVRDNSLPQQEGTPRILTALPSA
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtccttcccccagctgggctacccgcagtacctcagcgccagccaggcggtgtacggc
agcgagcggcccggggtgctggccgccgccgccgcagccgccgcagccgccgccgccgcc
tcgggccggcccgcgggcgccgaactgggcagcggctcggccgctgtcacctcggtgctg
ggcatgtacgcggggccctacagcgcccccaactacagcgccttcctgccctacaccgcc
gacctcggcctcttctcgcagatgggctcccagtacgagctgaaagataatccgggtgtc
catcctgctaccttcgcagcccacaccgcccccggctattatccctacggacagttccag
tatggggacccggggcgacccaaaaatgccacccgggagagtaccagcaccctcaaggcc
tggctcaatgaacaccgcaagaacccctaccctaccaagggcgagaagatcatgctggcc
atcatcaccaagatgaccctcacccaggtctccacctggttcgccaacgcccgccgccgc
ctcaagaaggagaacaaggtgacctggggctccaggagtaaggaccaagaagatgctaac
ctttttggcagcgataacgagggggaccctgagaagaccgaagacgatgaggagatcgac
ctggagagcatagacatagataaaattgatgaaaacgatggggaacagagcaatgaggaa
gaggaggagaagcctgagctcctgagacaaagcagtgaagaggagcgcttggaaaaagac
aaggaattgtcactgtcaggatctgaagggctgaaacccaaagatgctctggccatggtg
aaggaggcctctgacaacagcacgcgaatcattagccccgggggacagagcaatttacag
atgccatctcacagcaaacccaagatctggtctttggcagagactgcgaccagccctgat
ggtgccctgaaatcctcccccccaccacctccccctgcccaggtcacccacactttgcca
cagatccagcatcccgcctttctccccagccatggactctacacgtgccagattggcaag
tttcacaactggacaaatggggcttttctcacgcagagttccctgctaaacgtgaggtcg
tttttgggagtaaatcaccaccatgccactcaccacaaccaccacctccaggcccagcag
cagccttctgttttaacagccaccctgggagccctaagcagtgaaaagccttcagagagg
accagtcccaaacacatagaaaatgtcccaagaaccgattccccacctcagccactcaaa
tcgcccttccagcctgtccgcgacaactctttgcctcagcaagagggaactccgagaatt
ttaacagctctcccttcggcttga

DBGET integrated database retrieval system