KEGG   Gallus gallus (chicken): 374185
Entry
374185            CDS       T01006                                 
Symbol
IRX1
Name
(RefSeq) iroquois-class homeodomain protein IRX-1
  KO
K24889  iroquois-class homeodomain protein IRX
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    374185 (IRX1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain TALE
    374185 (IRX1)
SSDB
Motif
Pfam: Homeobox_KN Homeodomain Dicty_REP MRP-S32 EF-1_beta_acid
Other DBs
NCBI-GeneID: 374185
NCBI-ProteinID: NP_001025509
CGNC: 9961
Ensembl: ENSGALG00000030991
UniProt: Q9I9C5
Position
2:87109992..87114778
AA seq 467 aa
MSFPQLGYPQYLSASQAVYGSERPGVLAAAAAAAAAAAAASGRPAGAELGSGSAAVTSVL
GMYAGPYSAPNYSAFLPYTADLGLFSQMGSQYELKDNPGVHPATFAAHTAPGYYPYGQFQ
YGDPGRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR
LKKENKVTWGSRSKDQEDANLFGSDNEGDPEKTEDDEEIDLESIDIDKIDENDGEQSNEE
EEEKPELLRQSSEEERLEKDKELSLSGSEGLKPKDALAMVKEASDNSTRIISPGGQSNLQ
MPSHSKPKIWSLAETATSPDGALKSSPPPPPPAQVTHTLPQIQHPAFLPSHGLYTCQIGK
FHNWTNGAFLTQSSLLNVRSFLGVNHHHATHHNHHLQAQQQPSVLTATLGALSSEKPSER
TSPKHIENVPRTDSPPQPLKSPFQPVRDNSLPQQEGTPRILTALPSA
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtccttcccccagctgggctacccgcagtacctcagcgccagccaggcggtgtacggc
agcgagcggcccggggtgctggccgccgccgccgcagccgccgcagccgccgccgccgcc
tcgggccggcccgcgggcgccgaactgggcagcggctcggccgctgtcacctcggtgctg
ggcatgtacgcggggccctacagcgcccccaactacagcgccttcctgccctacaccgcc
gacctcggcctcttctcgcagatgggctcccagtacgagctgaaagataatccgggtgtc
catcctgctaccttcgcagcccacaccgcccccggctattatccctacggacagttccag
tatggggacccggggcgacccaaaaatgccacccgggagagtaccagcaccctcaaggcc
tggctcaatgaacaccgcaagaacccctaccctaccaagggcgagaagatcatgctggcc
atcatcaccaagatgaccctcacccaggtctccacctggttcgccaacgcccgccgccgc
ctcaagaaggagaacaaggtgacctggggctccaggagtaaggaccaagaagatgctaac
ctttttggcagcgataacgagggggaccctgagaagaccgaagacgatgaggagatcgac
ctggagagcatagacatagataaaattgatgaaaacgatggggaacagagcaatgaggaa
gaggaggagaagcctgagctcctgagacaaagcagtgaagaggagcgcttggaaaaagac
aaggaattgtcactgtcaggatctgaagggctgaaacccaaagatgctctggccatggtg
aaggaggcctctgacaacagcacgcgaatcattagccccgggggacagagcaatttacag
atgccatctcacagcaaacccaagatctggtctttggcagagactgcgaccagccctgat
ggtgccctgaaatcctcccccccaccacctccccctgcccaggtcacccacactttgcca
cagatccagcatcccgcctttctccccagccatggactctacacgtgccagattggcaag
tttcacaactggacaaatggggcttttctcacgcagagttccctgctaaacgtgaggtcg
tttttgggagtaaatcaccaccatgccactcaccacaaccaccacctccaggcccagcag
cagccttctgttttaacagccaccctgggagccctaagcagtgaaaagccttcagagagg
accagtcccaaacacatagaaaatgtcccaagaaccgattccccacctcagccactcaaa
tcgcccttccagcctgtccgcgacaactctttgcctcagcaagagggaactccgagaatt
ttaacagctctcccttcggcttga

DBGET integrated database retrieval system