KEGG   Gallus gallus (chicken): 374198Help
Entry
374198            CDS       T01006                                 

Gene name
APP
Definition
(RefSeq) amyloid-beta A4 protein precursor
  KO
K04520  amyloid beta A4 protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    374198 (APP)
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:gga00535]
    374198 (APP)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    374198 (APP)
Peptidases and inhibitors [BR:gga01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   374198 (APP)
Proteoglycans [BR:gga00535]
 Cell surface proteoglycans
  Others
   374198 (APP)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Others
   374198 (APP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APP_E2 APP_N APP_amyloid APP_Cu_bd Beta-APP Kunitz_BPTI Insulin_TMD
Motif
Other DBs
NCBI-GeneID: 374198
NCBI-ProteinID: NP_989639
CGNC: 49081
Ensembl: ENSGALG00000015770
UniProt: Q9DGJ7
Position
1
AA seq 751 aa AA seqDB search
MLPHLALLLLAAGAARALEVPADGNAGLLAEPQIAMFCGKLNMHMNVQNGKWESDPSGTK
TCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGWKQCNGHPHIVVPYRCLVG
EFVSDALLVPDKCKLLHQERMDVCETHLHWHTVAKESCSEKSMNLHDYGMLLPCGIDKFR
GVEFVCCPLAEESDNLDSADAEDDDSDVWWGGADADYADGSDDKVVEEQPEEDEELTVVE
DEDADDDDDDDGDEIEETEEEYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPC
RAMISRWYFDVAEGKCAPFFYGGCGGNRNNFDSEEYCMAVCGSVLPTTAASTPDAVDKYL
ETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKV
ESLEQEAANERQQLVETHMARVEAMLNDRRRIALENYITALQTVPPRPRHVFNMLKKYVR
AEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSFLYNVPAVAEEIQ
DEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVDGEFSLDDLQ
PWHPFGVDSVPANTENEVEPVDARPAADRGLTTRPGSGLTNVKTEEVSEVKMDAEFRHDS
GYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVD
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccacttagcccttttgctgctggccgccggcgccgcccgggcccttgaggtg
cctgctgatggaaatgctggattgttggcagagcctcaaattgccatgttctgtggcaaa
ctcaatatgcacatgaatgttcagaacggaaaatgggaatctgacccctctgggaccaag
acctgtatcgacactaaagaagggattctgcagtattgccaggaagtttaccctgaattg
caaattaccaatgttgtcgaagccaaccagccggttacaatccagaattggtgcaagaga
ggatggaagcagtgcaatggtcacccacatattgtggttccctacaggtgtttggtgggt
gagtttgtgagtgatgcccttctggtaccggacaagtgcaagttgcttcaccaggaaagg
atggatgtgtgtgaaactcacctgcactggcatactgttgctaaagagtcctgcagcgag
aagagtatgaatctgcatgactatggcatgctgctgccctgtggaattgacaagtttcgt
ggtgtggaatttgtttgctgcccattagcagaggaaagcgacaatcttgactcagctgat
gctgaagatgatgattcagatgtctggtggggaggcgcagatgcagactatgcagatgga
agcgatgataaggtggtagaagaacaaccagaggaagacgaggagctaactgttgtggag
gatgaagatgctgatgatgatgacgatgatgatggtgatgaaattgaagagacagaggag
gagtatgaggaagcaacagaaagaactaccagtatcgcaaccactaccaccacaactaca
gagtccgtggaagaagttgtcagagaggtgtgctctgaacaagctgagaccggtccctgc
cgtgcaatgatctcccgctggtactttgacgtggccgaaggaaagtgcgcgcccttcttt
tacggcggctgcggtggcaaccggaacaactttgactcggaggagtactgcatggcagtc
tgcggcagcgtcctccctaccacagctgctagcactcctgatgctgttgacaaatacttg
gagacacctggggatgaaaatgaacatgctcatttccagaaagccaaggagaggcttgaa
gctaagcatcgtgaaaggatgtctcaggtcatgagggaatgggaggaggcagaacgccaa
gcaaagaatttgccaaaggctgacaagaaagctgttatccagcatttccaggagaaagtg
gaatcactggaacaagaagcagcaaatgaaaggcaacagcttgtggagactcacatggca
cgggtggaagccatgctgaatgaccgtcgccgcattgctctggagaactacattacagca
ctgcagactgtcccacccagacctcgtcacgtattcaacatgctgaagaagtatgtgcgt
gctgagcagaaagacagacagcatactctcaaacacttcgaacatgtccggatggtagac
ccaaagaaagctgcccagattagatctcaggttatgacacatctacgtgtgatatacgaa
cgcatgaaccagtctctctccttcctctacaatgtgcctgctgtagctgaggagatccag
gatgaagtcgatgagttgcttcagaaagagcaaaactactctgacgatgttctggccaat
atgatcagcgaacctagaatcagctatggaaatgatgctctcatgccttcattgacggaa
actaagaccacagttgaacttcttccagtggatggagagttcagtctcgatgaccttcag
ccatggcatccctttggtgttgattctgttccagccaatactgaaaatgaagttgagcct
gttgatgcccgcccagctgcagacagaggactcaccacacgaccaggttctggcttgacc
aatgttaaaacagaagaggtatctgaagtaaagatggatgcggagttccgacatgactca
ggatatgaagtgcatcatcaaaagctggtgttctttgctgaagatgtgggttcaaataaa
ggtgccatcattggactaatggtgggaggtgttgtcatagcgacagtgattgtcattact
ctggtgatgctgaagaagaagcagtacacatctattcatcatggggttgtggaggtggat
gctgcagtgacaccagaggagcgccacctctccaagatgcagcagaacggctacgagaac
cccacctacaagttcttcgaacagatgcagaattag

DBGET integrated database retrieval system