KEGG   Gallus gallus (chicken): 374201
Entry
374201            CDS       T01006                                 

Gene name
PITX1
Definition
(RefSeq) pituitary homeobox 1
  KO
K09356  paired-like homeodomain transcription factor 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    374201 (PITX1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    374201 (PITX1)
SSDB
Motif
Pfam: Homeodomain OAR Homeobox_KN
Other DBs
NCBI-GeneID: 374201
NCBI-ProteinID: NP_001161156
CGNC: 4791
Ensembl: ENSGALG00000030237
Position
13
AA seq 302 aa
MDSFKGGMNLERLPESLRPQPSHDMASSFHLQRSSEPRDPIENSASESSDTEVPEKERSG
EQKNEDGAADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEP
RVRVWFKNRRAKWRKRERNQQMDLCKNGYVPQFSGLMQPYDDMYAGYPYNKWATKSLTPA
PLSTKSFTFFNSMSPLSSQSMFSAPSSISSMNMPSGMGHSAVPGMANSGLNNINNISGSS
LNSAMSSPACPYGPPGSPYSVYRDTCNSSLASLRLKSKQHSSFGYSSLQSPGSSLNACQY
NS
NT seq 909 nt   +upstreamnt  +downstreamnt
atggattcctttaaaggtggaatgaatttggagagactgcccgagagcttgagaccccaa
ccctcccatgacatggcttccagcttccatttgcaaagatcctcggagcccagagacccg
atcgagaactcggccagtgaatcctccgacacggaggtgccagaaaaagagagaagcgga
gagcagaaaaacgaggacggggccgccgacgacccggcgaagaagaagaagcaacggagg
cagcggacccacttcaccagccagcagctgcaggagctggaagccactttccagcggaac
cgctaccccgatatgagcatgcgggaggagatcgccgtgtggacgaacctcaccgagccc
cgcgtccgggtgtggttcaagaaccgccgagccaagtggagaaagcgggagcggaaccag
cagatggacctgtgcaagaacggctacgtgccgcagttcagcgggctgatgcagccctac
gacgacatgtacgccgggtacccctacaacaaatgggccaccaaaagcctcaccccggcg
ccgctctccaccaagagcttcaccttcttcaactccatgagccccctctcctcgcagtcc
atgttctcggctcccagcagcatctcctccatgaacatgccctccgggatgggccactcg
gccgtgccgggcatggccaactccggcctcaacaacatcaacaacatcagcggctcctcg
ctcaactcggccatgtcctcgcccgcttgtccctatgggccgccgggctctccctacagc
gtgtaccgggacacttgtaactccagcctggccagcctcagactgaaatcaaagcagcac
tccagtttcggctacagcagtttgcagagccccggctccagcctaaacgcctgtcagtac
aacagttga

DBGET integrated database retrieval system